Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

2308, FOXO1

Organisms

Human (9606)

Synonyms

FKH1|FKHR|FOXO1A;
FOXO1;
forkhead box O1;
OTTHUMP00000018301|forkhead box O1A (rhabdomyosarcoma)|forkhead homolog in rhabdomyosarcoma|forkhead, Drosophila, homolog of, in rhabdomyosarcoma

Description

forkhead box O1

Xrefs

HGNC:3819| MIM:136533| Ensembl:ENSG00000150907| HPRD:00645

Chromosome

13 : 13q14.1

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

2538 2308 PMID: 11672436

Sequence Information

Nucleotide sequence

>2308 : length: 1968
atggccgaggcgcctcaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcagcgcggctgccaaccccgacgccgcggcgggcctgccctcg
gcctcggctgccgctgtcagcgccgacttcatgagcaacctgagcttgctggaggagagc
gaggacttcccgcaggcgcccggctccgtggcggcggcggtggcggcggcggccgccgcg
gccgccaccggggggctgtgcggggacttccagggcccggaggcgggctgcctgcaccca
gcgccaccgcagcccccgccgcccgggccgctgtcgcagcacccgccggtgccccccgcc
gccgctgggccgctcgcggggcagccgcgcaagagcagctcgtcccgccgcaacgcgtgg
ggcaacctgtcctacgccgacctcatcaccaaggccatcgagagctcggcggagaagcgg
ctcacgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataag
ggtgacagcaacagctcggcgggctggaagaattcaattcgtcataatctgtccctacac
agcaagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaat
ccagagggtggcaagagcgggaaatctcctaggagaagagctgcatccatggacaacaac
agtaaatttgctaagagccgaagccgagctgccaagaagaaagcatctctccagtctggc
caggagggtgctggggacagccctggatcacagttttccaaatggcctgcaagccctggc
tctcacagcaatgatgactttgataactggagtacatttcgccctcgaactagctcaaat
gctagtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaa
ggggatgtgcattctatggtgtacccgccatctgccgcaaagatggcctctactttaccc
agtctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaacctt
ctctcatcaccaacatcattaactgtttcgacccagtcctcacctggcaccatgatgcag
cagacgccgtgctactcgtttgcgccaccaaacaccagtttgaattcacccagcccaaac
taccaaaaatatacatatggccaatccagcatgagccctttgccccagatgcctatacaa
acacttcaggacaataagtcgagttatggaggtatgagtcagtataactgtgcgcctgga
ctcttgaaggagttgctgacttctgactctcctccccataatgacattatgacaccagtt
gatcctggggtagcccagcccaacagccgggttctgggccagaacgtcatgatgggccct
aattcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcccagc
tcccatacccaccctggacatgctcagcagacatctgcagttaacgggcgtcccctgccc
cacacggtaagcaccatgccccacacctcgggtatgaaccgcctgacccaagtgaagaca
cctgtacaagtgcctctgccccaccccatgcagatgagtgccctggggggctactcctcc
gtgagcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagt
gacttggatggcatgttcattgagcgcttagactgtgacatggaatccatcattcggaat
gacctcatggatggagatacattggattttaactttgacaatgtgttgcccaaccaaagc
ttcccacacagtgtcaagacaacgacacatagctgggtgtcaggctga

Protein sequence

>2308 : length: 655
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min