Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

5208, PFKFB2

Organisms

Human (9606)

Synonyms

DKFZp781D2217|MGC138308|MGC138310|PFK-2/FBPase-2;
PFKFB2;
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2;
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2|6PF-2-K/Fru-2,6-P2ASE heart-type isozyme|OTTHUMP00000034285|OTTHUMP00000034286|PFKFB, cardiac|fructose-2,6-bisphosphatase, cardiac isozyme

Description

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2

Xrefs

HGNC:8873| MIM:171835| Ensembl:ENSG00000123836| HPRD:01383

Chromosome

1 : 1q31

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

2645 5208 PMID: 11522786

Sequence Information

Nucleotide sequence

>5208 : length: 1416
atgtctggggcatcttcctcagaacagaacaacaacagctatgaaaccaaaaccccaaat
cttcgaatgtcagagaagaaatgttcatgggcctcctacatgaccaactccccgactctg
atcgttatgattggtttgccagcccggggtaaaacctacgtgtccaagaaactaacacgc
tacctcaactggattggagtccccaccaaagtgtttaatcttggggtgtatcggcgtgaa
gcagtcaagtcctataagtcctacgacttctttcggcatgacaatgaggaggccatgaag
atccgcaaacagtgtgctctggtggcgctggaagatgttaaggcgtatctcactgaggag
aatggtcagattgcggtgtttgatgccaccaatacaacccgggagaggagggacatgatt
ttgaactttgctgaacagaattccttcaaggtattctttgtggaatccgtctgtgatgat
cctgatgtcattgctgccaatattctggaggttaaggtatcaagccctgactatcctgaa
aggaacagagagaacgtgatggaggacttcctgaagagaattgaatgctacaaagttacc
taccgacctcttgacccagacaactatgacaaggatctttctttcatcaaggtgataaac
gtgggccagcgatttttagtcaacagagtccaggactacatccagagcaagatagtctac
tacctcatgaatatccacgtccagcctcgcaccatttacctttgccggcatggagaaagc
gagttcaatctcttggggaagattgggggtgactctggcctctcggtgcggggaaagcag
tttgcccaagctctaaggaaatttctggaggaacaggaaataacagacctcaaagtgtgg
acaagccagttgaagaggaccatacagactgctgaatctctcggggtgccctatgagcag
tggaagattctgaatgagattgatgctggtgtgtgtgaagagatgacctatgcagagatt
gagaaacggtacccagaagagtttgcacttcgagatcaagagaagtatctgtatcgatat
cctggtggggagtcataccaggacctggtgcagcggctggagcctgtcatcatggagctg
gaacgtcagggcaatgtcctcgtcatctcccaccaggctgtcatgcgctgcctcctggcc
tacttcttggataagggcgcagatgagctaccatacttgagatgccctctccataccatc
ttcaaacttactcctgtggcctatgggtgcaaagtggaaacaattaaacttaacgtggag
gctgtgaacacgcaccgtgacaagccaactgcagcagagaccacactggctgtgcgcaga
cgcccctccgcagcgtccctcatgttgccttgctaa

Protein sequence

>5208 : length: 471
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTR
YLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEE
NGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPE
RNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVY
YLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW
TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRY
PGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTAAETTLAVRRRPSAASLMLPC



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min