Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

5315, PKM2

Organisms

Human (9606)

Synonyms

CTHBP|MGC3932|OIP3|PK3|PKM|TCB|THBP1;
PKM2;
pyruvate kinase, muscle;
OPA-interacting protein 3|PK, muscle type|pyruvate kinase M2|thyroid hormone-binding protein, cytosolic

Description

pyruvate kinase, muscle

Xrefs

HGNC:9021| MIM:179050| Ensembl:ENSG00000067225| HPRD:01529

Chromosome

15 : 15q22

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5315 8470 PMID: 15128873
5315 5315 PMID: 16189514
5315 5315 PMID: 11960989
5315 369 PMID: 12620389
5315 5894 PMID: 12620389
5315 56915 PMID: 16189514
5315 56915 PMID: 15231747

Sequence Information

Nucleotide sequence

>5315 : length: 1596
atgtcgaagccccatagtgaagccgggactgccttcattcagacccagcagctgcacgca
gccatggctgacacattcctggagcacatgtgccgcctggacattgattcaccacccatc
acagcccggaacactggcatcatctgtaccattggcccagcttcccgatcagtggagacg
ttgaaggagatgattaagtctggaatgaatgtggctcgtctgaacttctctcatggaact
catgagtaccatgcggagaccatcaagaatgtgcgcacagccacggaaagctttgcttct
gaccccatcctctaccggcccgttgctgtggctctagacactaaaggacctgagatccga
actgggctcatcaagggcagcggcactgcagaggtggagctgaagaagggagccactctc
aaaatcacgctggataacgcctacatggaaaagtgtgacgagaacatcctgtggctggac
tacaagaacatctgcaaggtggtggaagtgggcagcaagatctacgtggatgatgggctt
atttctctccaggtgaagcagaaaggtgccgacttcctggtgacggaggtggaaaatggt
ggctccttgggcagcaagaagggtgtgaaccttcctggggctgctgtggacttgcctgct
gtgtcggagaaggacatccaggatctgaagtttggggtcgagcaggatgttgatatggtg
tttgcgtcattcatccgcaaggcatctgatgtccatgaagttaggaaggtcctgggagag
aagggaaagaacatcaagattatcagcaaaatcgagaatcatgagggggttcggaggttt
gatgaaatcctggaggccagtgatgggatcatggtggctcgtggtgatctaggcattgag
attcctgcagagaaggtcttccttgctcagaagatgatgattggacggtgcaaccgagct
gggaagcctgtcatctgtgctactcagatgctggagagcatgatcaagaagccccgcccc
actcgggctgaaggcagtgatgtggccaatgcagtcctggatggagccgactgcatcatg
ctgtctggagaaacagccaaaggggactatcctctggaggctgtgcgcatgcagcacctg
attgcccgtgaggcagaggctgccatctaccacttgcaattatttgaggaactccgccgc
ctggcgcccattaccagcgaccccacagaagccaccgccgtgggtgccgtggaggcctcc
ttcaagtgctgcagtggggccataatcgtcctcaccaagtctggcaggtctgctcaccag
gtggccagataccgcccacgtgcccccatcattgctgtgacccggaatccccagacagct
cgtcaggcccacctgtaccgtggcatcttccctgtgctgtgcaaggacccagtccaggag
gcctgggctgaggacgtggacctccgggtgaactttgccatgaatgttggcaaggcccga
ggcttcttcaagaagggagatgtggtcattgtgctgaccggatggcgccctggctccggc
ttcaccaacaccatgcgtgttgttcctgtgccgtga

Protein sequence

>5315 : length: 531
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min