Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

56915, EXOSC5

Organisms

Human (9606)

Synonyms

MGC111224|MGC12901|RRP41B|RRP46|Rrp46p|hRrp46p|p12B;
EXOSC5;
exosome component 5;
exosome component Rrp46

Description

exosome component 5

Xrefs

HGNC:24662| MIM:606492| Ensembl:ENSG00000077348| HPRD:16222

Chromosome

19 : 19q13.1

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5315 56915 PMID: 16189514
5315 56915 PMID: 15231747

Sequence Information

Nucleotide sequence

>56915 : length: 708
atggaggaggagacgcatactgacgccaaaatccgtgctgaaaatggaacagggtccagc
cctcggggtcctggctgcagcctccggcactttgcctgcgaacagaacctgctgtcgcgg
ccagatggctctgcttccttcctgcaaggtgacacctctgtcctggcgggtgtgtacggg
ccggccgaggtgaaggtcagcaaagagattttcaacaaggccacactcgaagtgatcctg
aggccgaagattgggctgcctggtgttgcagagaagagccgggagcggctgatcaggaac
acgtgcgaggcggtggtgctgggcacgttgcacccccgcacctccatcaccgtggtgctg
caggttgtcagcgatgccggctctctcctggcctgttgtctgaatgccgcctgcatggca
ttggtggatgcaggtgtgcccatgcgggctctcttctgtggggtcgcctgcgccctggac
tctgatgggaccctcgtgctggatcctacatccaagcaagaaaaggaggcccgggcagtc
ctgacctttgccctggacagcgtggaacggaagctgctgatgtccagcaccaaggggctc
tactcagacactgagctccagcagtgcctggctgcggcccaggccgcttcgcaacacgtc
ttccgtttctaccgggaatcgctgcagaggcgttactccaagagctga

Protein sequence

>56915 : length: 235
MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYG
PAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVL
QVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAV
LTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min