Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

8470, SORBS2

Organisms

Human (9606)

Synonyms

ARGBP2|FLJ93447|KIAA0777|PRO0618;
SORBS2;
sorbin and SH3 domain containing 2;
Arg binding protein 2|Arg/Abl interacting protein|Arg/Abl-interacting protein 2

Description

sorbin and SH3 domain containing 2

Xrefs

HGNC:24098| Ensembl:ENSG00000154556| HPRD:12473

Chromosome

4 : 4q35.1

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

5315 8470 PMID: 15128873

Sequence Information

Nucleotide sequence

>8470 : length: 2001
atgaacacagggcgtgattctcagtcaccagactcagcaaaaggttttagaagcgttcga
ccaaacctacaagataaaagatcaccaactcagagccagataacagtgaatggaaactca
ggaggtgccgtgagtcccatgagttactatcagaggccgttttccccctcggcatattct
ctcccagcctcactcaactccagcattgtcatgcagcacggcacatccctcgattccaca
gacacatatccccagcatgcgcagtctctggatggcaccaccagcagctctatccccctg
taccgatcctcagaggaagagaagagagtgacagtcatcaaagccccgcattacccaggg
atcgggcccgtggatgaatccggaatccccacagcaattagaacgacagtcgaccggccc
aaggactggtacaagacgatgtttaagcaaattcacatggtgcacaagccggatgatgac
acagacatgtataatactccttatacatacaatgcaggtctgtacaacccaccctacagt
gctcagtcacaccctgctgcaaagacccaaacctacagacctctttccaaaagccactcc
gacaacagccccaatgcctttaaggatgcgtcctccccagtgcctcccccacatgttcca
cctccagtcccgccgcttcgaccaagagatcggtcttcaacagaaaagcatgactgggat
cctccagacagaaaagtggacacaagaaaatttcggtctgagccaaggagtatttttgaa
tatgaacctggcaagtcatcaattcttcagcatgaaagaccaactgatcgcataaatcca
gatgacatagatttagaaaatgagccctggtataaattcttttcagaactggagtttgga
cgcccgcctcctaaaaagcctctggactatgttcaagatcattcttctggtgttttcaat
gaggcctccttgtatcagtcctctatagacagaagcctggaaagacccatgagttctgca
agcatggccagtgacttcaggaagcggaggaagagcgagcctgcagtgggtccaccacgg
ggcttgggagatcaaagtgcgagcaggactagcccaggccgagtggacctcccaggatca
agcaccactcttacaaagtctttcactagctcttctccttcttccccatcaagagcaaaa
gaccgtgagtcccctagaagttactcatccactttgactgacatggggagaagtgcacca
agggaaagaagaggaactccagaaaaagagaaattgcctgcaaaagctgtttatgatttt
aaggctcagacatctaaggagttgtcatttaagaaaggagatactgtctacatcctcagg
aaaattgatcaaaattggtatgagggagaacaccacgggagagtgggcatcttcccgatc
tcatacgtagagaaactcacacctcctgagaaagcacagcctgcaagaccacctccgcca
gcccagcccggagaaatcggagaagctatagccaaatacaacttcaacgcagacacaaat
gtggagctgtcactgagaaagggagatagagttattcttcttaaaagagttgatcaaaac
tggtatgaaggtaaaatcccaggaaccaacagacaaggcatcttccctgtttcctatgtg
gaggtcgtcaagaagaacacaaaaggtgctgaggactaccctgaccctccaataccccac
agctattctagtgataggattcacagcttgagctcaaataagccacagcgtcctgtgttt
actcatgaaaatattcaaggtgggggggaaccgtttcaggctctgtataactatactccc
aggaatgaagatgagctggagctcagagaaagtgatgtcattgatgtcatggaaaagtgt
gatgacggctggtttgtggggacctcaagaagaaccaaattctttggtactttccccgga
aactacgtcaagaggctgtga

Protein sequence

>8470 : length: 666
MNTGRDSQSPDSAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPMSYYQRPFSPSAYS
LPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPG
IGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYS
AQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWD
PPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPTDRINPDDIDLENEPWYKFFSELEFG
RPPPKKPLDYVQDHSSGVFNEASLYQSSIDRSLERPMSSASMASDFRKRRKSEPAVGPPR
GLGDQSASRTSPGRVDLPGSSTTLTKSFTSSSPSSPSRAKDRESPRSYSSTLTDMGRSAP
RERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPI
SYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLRKGDRVILLKRVDQN
WYEGKIPGTNRQGIFPVSYVEVVKKNTKGAEDYPDPPIPHSYSSDRIHSLSSNKPQRPVF
THENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG
NYVKRL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min