Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850346, GBP2

Organisms

Yeast (4932)

Synonyms

YCL011C;
RLF6;
Poly(A+) RNA-binding protein, involved in the export of mRNAs from the nucleus to the cytoplasm; similar to Hrb1p and Npl3p; also binds single-stranded telomeric repeat sequence in vitro

Description

Gbp2p

Xrefs

SGD:S000000517

Chromosome

III : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 850346 PMID: 16429126
851152 850346 PMID: 17200106
851152 850346 PMID: 11805837

Sequence Information

Nucleotide sequence

>850346 : length: 1284
atggagagagagctagggatgtatggaaatgataggagtagatcaagatcacctgtacgt
cgtcgtttgagcgacgacagagacaggtacgatgattataacgatagtagcagtaataat
ggtaatggcagtcgtcgtcagagacgcgaccgaggctcccgtttcaatgatcggtacgat
cagagttatggtggcagccgctaccacgatgataggaactggccccctcgccgaggaggc
cgtggcagaggaggaagcagatcattcagagggggacgcggtggcggtaggggtcgtact
ttaggtccaattgttgaaagagacttagaaaggcaatttgacgcgaccaagagaaatttt
gaaaatagtatcttcgtgagaaacttgacttttgattgtacccctgaagaccttaaggaa
ttgtttggtacagtgggcgaagttgtggaggctgacattatcacatcaaagggccatcac
cgtggtatggggactgtggaatttaccaaaaacgaatctgtccaagatgccatatcgaag
tttgatggtgccctctttatggaccggaaactaatggtaagacaggataatcctcctcct
gaagctgccaaggaattttctaagaaagctactagggaagaaatagataatgggtttgaa
gtgttcatcatcaatttaccgtactctatgaattggcaatccttaaaagatatgtttaaa
gaatgtggtcatgtcttgcgtgccgatgtagaattggatttcaacggattttcaagagga
ttcggttctgtcatttatcctactgaggatgaaatgattagagctatcgatacattcaac
ggcatggaagtagaaggtagagttttggaagttagagaagggcgtttcaacaagagaaag
aacaatgatcgttataatcaaaggcgtgaggaccttgaagataccagaggtactgaacca
ggtcttgcgcaggatgccgctgtccacattgatgaaactgcagcaaaatttactgaaggt
gtcaatccaggaggggatagaaactgtttcatttattgtagtaatttaccattctcaaca
gcaagaagcgatttattcgacttgtttgggcctatcggcaaaatcaataacgcggaattg
aaaccacaggaaaatggtcaaccaactggtgttgctgttgtagaatatgaaaatttagta
gatgcagatttttgtattcaaaaattaaataattataattatggtggttgtagtttacag
atctcttatgctagacgtgattaa

Protein sequence

>850346 : length: 427
MERELGMYGNDRSRSRSPVRRRLSDDRDRYDDYNDSSSNNGNGSRRQRRDRGSRFNDRYD
QSYGGSRYHDDRNWPPRRGGRGRGGSRSFRGGRGGGRGRTLGPIVERDLERQFDATKRNF
ENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKGHHRGMGTVEFTKNESVQDAISK
FDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFK
ECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRK
NNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFST
ARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQ
ISYARRD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min