Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850623, PRP19

Organisms

Yeast (4932)

Synonyms

YLL036C;
PSO4;
Splicing factor associated with the spliceosome; contains a U-box, a motif found in a class of ubiquitin ligases

Description

Prp19p

Xrefs

SGD:S000003959

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 850623 PMID: 11804584
854948 850623 PMID: 11804584
851152 850623 PMID: 11804584

Sequence Information

Nucleotide sequence

>850623 : length: 1512
atgctttgtgctattagtgggaaagttcctagaaggccagttctatcacctaaatccagg
actatttttgaaaagtcgctccttgaacagtatgttaaagatacggggaatgatccgata
acaaatgagcccttaagcatcgaagaaatagtggaaatcgtacctagtgcgcaacaagcc
tcactaacagagtctacaaactctgctacgttaaaagcgaattattcgattccgaatctg
ttgacaagtttacagaatgaatgggatgctataatgctcgaaaactttaagttacgatca
actctagatagtttaacgaaaaaactgtcgactgtaatgtacgaaagagatgctgcaaag
ttggtcgctgcgcaactattgatggaaaaaaacgaagattcgaaggatttacccaaatcc
tcacagcaagcggtagctattacgagagaagaatttttacaagggctgttacaatcttct
agagactttgtagcgaggggcaagctcaaagcacccaaatggccgattttaaaaaatttg
gagctattacaggcacaaaattactcccgtaacatcaaaacattcccatataaagagctt
aacaaatctatgtactatgataaatgggtgtgcatgtgtcgctgtgaggatggtgcttta
cattttacccaattaaaagattcgaaaacgattaccacaataactacaccaaatccccgt
accgggggagagcatccagctattatttccagagggccttgtaatcgtttgctactacta
tatccaggtaaccaaataactatattggactcaaaaacaaacaaagtcctcagagaaata
gaggtagattccgccaatgagattatatatatgtatggtcacaacgaggtcaacacagag
tacttcatctgggcggataatagaggaaccataggatttcaatcctacgaggatgattcc
cagtatattgttcattctgctaaatcagatgttgagtacagcagcggtgtcctacataag
gattcattattattagccctttactctccggacggtatattagacgtttacaacttgtca
tcacctgaccaggcaagctctagattccccgtagatgaagaagccaagataaaagaggtt
aaatttgcagacaatgggtactggatggtagtagagtgtgaccaaactgtggtttgcttt
gacctaagaaaggatgtcggcacgctagcgtatccaacttacacaatcccagaattcaag
acgggcaccgttacctatgacattgacgactctggaaagaatatgattgcatactcaaac
gagagcaattcgctgacgatatacaaatttgacaagaaaacaaaaaattggactaaagac
gaggagagcgccctctgtttgcaaagcgacactgccgatttcactgatatggacgtggta
tgcggagatggtggtattgccgctattctgaagacaaatgatagtttcaatattgttgca
ttgacaccctaa

Protein sequence

>850623 : length: 503
MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQQA
SLTESTNSATLKANYSIPNLLTSLQNEWDAIMLENFKLRSTLDSLTKKLSTVMYERDAAK
LVAAQLLMEKNEDSKDLPKSSQQAVAITREEFLQGLLQSSRDFVARGKLKAPKWPILKNL
ELLQAQNYSRNIKTFPYKELNKSMYYDKWVCMCRCEDGALHFTQLKDSKTITTITTPNPR
TGGEHPAIISRGPCNRLLLLYPGNQITILDSKTNKVLREIEVDSANEIIYMYGHNEVNTE
YFIWADNRGTIGFQSYEDDSQYIVHSAKSDVEYSSGVLHKDSLLLALYSPDGILDVYNLS
SPDQASSRFPVDEEAKIKEVKFADNGYWMVVECDQTVVCFDLRKDVGTLAYPTYTIPEFK
TGTVTYDIDDSGKNMIAYSNESNSLTIYKFDKKTKNWTKDEESALCLQSDTADFTDMDVV
CGDGGIAAILKTNDSFNIVALTP



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min