Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850682, RPL8B

Organisms

Yeast (4932)

Synonyms

YLL045C;
KRB1|SCL41;
Rpl8bp

Description

Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Ap and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits

Xrefs

SGD:S000003968

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 850682 PMID: 16429126
851152 850682 PMID: 17200106

Sequence Information

Nucleotide sequence

>850682 : length: 771
atggctccaggtaagaaagttgctccagctccattcggtgctaagtccactaagtctaac
aaggctaagaacccattgactcactctactccaaagaacttcggtattggccaagctgtc
caaccaaagagaaacttgtccagatacgtcaaatggccagaatatgtcagattgcaaaga
caaaagaagatcttgtccatcagattgaaggttcctccaaccattgctcaattccaatac
actttggacagaaacaccgctgctgaaaccttcaagttgttcaacaagtacagaccagaa
accgctgctgaaaagaaggaaagattgaccaaggaagctgccgctatcgctgaaggtaag
tctaagcaagacgcttctccaaagccatacgctgttaagtacggtttgaaccatgttgtc
tctttgattgaaaacaagaaggccaagttggttttgattgctaacgacgtcgacccaatt
gaattggttgttttcctaccagctttgtgtaagaagatgggtgttccatacgccattatc
aagggtaaggctagattgggtactttggttaaccaaaagacttctgctgttgccgctttg
accgaagtcagagccgaagacgaagctgctttggctaagttggtttccaccattgacgct
aacttcgctgacaaatacgatgaagtcaagaagcactggggcggtggtatccttggtaac
aaggctcaagctaagatggacaagagagctaagacttccgactccgcttaa

Protein sequence

>850682 : length: 256
MAPGKKVAPAPFGAKSTKSNKAKNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRLQR
QKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAIAEGK
SKQDASPKPYAVKYGLNHVVSLIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAII
KGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGN
KAQAKMDKRAKTSDSA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min