Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850716, RPL15A

Organisms

Yeast (4932)

Synonyms

YLR029C;
RPL10A;
Rpl15ap

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl15Bp and has similarity to rat L15 ribosomal protein; binds to 5.8 S rRNA

Xrefs

SGD:S000004019

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 850716 PMID: 17200106

Sequence Information

Nucleotide sequence

>850716 : length: 615
atgggtgcctacaaatatttggaagaattgcaaagaaagaagcaatctgatgttttgaga
ttcttgcaaagagtcagagtctgggaatacagacaaaagaatgtcattcacagagccgct
agaccaactagaccagacaaggctagaagattgggttacaaagctaagcaaggtttcgtt
atctaccgtgtcagagttagacgtggtaacagaaagagacctgttccaaagggtgctact
tacggtaagccaactaaccaaggtgtcaatgaattgaaataccaaagatccttgagagct
accgctgaagaaagagttggtcgtcgtgccgctaacttgagagtcttgaactcctactgg
gttaaccaagattctacttacaagtacttcgaagttatcttggtcgaccctcaacacaag
gctatcagaagagatgctcgttacaactggatctgtgacccagttcacaagcaccgtgaa
gctagaggtttgactgccactggtaagaaatccagaggtatcaacaagggtcacaaattc
aacaacaccaaggctggtagaagaaagacctggaagagacaaaacactttgtccttgtgg
agatacagaaaataa

Protein sequence

>850716 : length: 204
MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRLGYKAKQGFV
IYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYW
VNQDSTYKYFEVILVDPQHKAIRRDARYNWICDPVHKHREARGLTATGKKSRGINKGHKF
NNTKAGRRKTWKRQNTLSLWRYRK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min