Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850737, RPS0B

Organisms

Yeast (4932)

Synonyms

YLR048W;
YST2;
Rps0bp

Description

Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Ap; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal

Xrefs

SGD:S000004038

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854303 850737 PMID: 16429126
851152 850737 PMID: 16429126

Sequence Information

Nucleotide sequence

>850737 : length: 759
atgtctttaccagctacttttgatttgactccagaggatgcccaacttttgttggccgct
aacacccatttaggtgctagaaacgttcaagtccaccaagaaccatacgttttcaatgct
agaccagatggtgttcacgttatcaatgttggtaagacctgggaaaagttggttttggct
gctagaattattgctgccattccaaacccagaagatgttgttgccatctcttccagaacc
tacggtcaaagagctgtcttgaaatttgctgctcacactggtgctactccaatcgccggt
agattcactccaggttctttcactaattacatcacccgttctttcaaggaaccaagattg
gttattgttaccgacccaagattagacgctcaggccattaaggaagcttcttacgttaac
attccagtcattgctttgactgatttggactccccatctgaatttgttgatgtcgccatc
ccatgtaacaacagaggtaagcactccatcggtttaatctggtacttgttggctagagaa
gttttgagactaagaggtgctttggtcgacagaactcaaccatggtccatcatgccagat
ttgtacttctacagaaacccagaagaagttgagcaagttgctgaagaagctgctgccgct
gaagaaggtgaagaagaagaagttaaggaagaagtcactgaaggtcaagctgaagctact
gaatgggctgaagaaaatgcagacaacgttgaatggtaa

Protein sequence

>850737 : length: 252
MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLA
ARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRL
VIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLARE
VLRLRGALVDRTQPWSIMPDLYFYRNPEEVEQVAEEAAAAEEGEEEEVKEEVTEGQAEAT
EWAEENADNVEW



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min