Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850863, SEC10

Organisms

Yeast (4932)

Synonyms

YLR166C;
Sec10p

Description

Essential 100kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating polarized targeting of secretory vesicles to active sites of exocytosis

Xrefs

SGD:S000004156

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 850863 PMID: 16624861

Sequence Information

Nucleotide sequence

>850863 : length: 2616
atgaactcattatatgaactcgatccgaaatggaagaaactattgaaaacggacaatttc
ctgggcggattaacagtcaatgaattcgttcaggaattgagcaaagaccatcgtaatgac
gtgttgattgatgcaaacacgaaaaatcttccaaccaatgaaaaggatcaggatgcaatc
agagaggctatttggaaacaattagatccaaaaccttacattagaacttttgaatctacc
ttaaaggaactaaaaaacttaaatgaggaaacactaaataaaagacagtatttttccgag
caagtggctactcaggaagttattcattcggagaatgtgataaaattatccaaggatttg
catactactttacttacattcgacaagctagatgatcgcttgacaaatgttactcaagtt
gtttcgccattgggagataaattagaaaccgcaatcaagaaaaagcaaaactatattcaa
agtgtggaattgattcgcaggtacaatgacttttattccatgggaaaatcagatattgtt
gaacaattaaggctgtctaaaaactggaaattaaacttaaagtccgtgaaattaatgaag
aatctattgatattatcatccaaactagagacaagttcaataccaaaaacaataaacaca
aagctggttattgaaaagtactctgaaatgatggaaaatgagctgttagagaattttaat
tctgcatatagagagaataattttactaaattaaatgaaattgccatcattctcaacaat
tttaatggcggtgttaatgtcattcaaagcttcatcaatcagcacgattatttcattgac
accaagcagattgacttggaaaatgaatttgagaatgttttcataaaaaacgtgaagttt
aaggaacagctgattgattttgagaaccacagtgttatcatcgagacatccatgcaaaat
ttgataaatgatgtggaaactgtaataaaaaatgaatccaagattgttaaaagggtattt
gaagaaaaggcaactcatgtgatacaattgtttattcaaagagtttttgctcaaaaaatt
gaaccaagatttgaggttttattgaggaattccctgtcaatctcaaatttggcttatgtg
agaatattacacggactgttcactttatttggtaagttcactaaaagtttaattgattac
tttcaactattagaaattgacgacagtaaccaaatcttatcaacaaccctagaacaatgt
tttgctgatttgttttcgcattatctatatgataggtccaaatatttcggtattgagaaa
agatccttggaagcgattctagtggatatgacatccaagtttactgtaaactatgataaa
gaaatcaacaagagggttttattagataagtataaggagaaactatcaactaatgtggat
gcattcatgcattctcctagagggaatacacactctcgtcaagattcaacatcaaggagt
aaattgtcacaatttaattcctttttgaaaactcatttagataaagatcatttgagtcta
aaccgtacaaatactttgagcgattcgtttaacaacagctcttcttctacgcagtatgat
gtagcaaacaactcttcaagtttggtaaattctagttttacagcaagcgatattgataac
agtccaaacagtccggcgaactattctttgaacgatgttgattctatgttaaaatgtgtg
gtggagtctactgcaagagtaatggaactaattccaaacaaagcacatctatacatccta
gaaatattaaaaataatgtttttgggaattgttgattcgtacatggaaattgcgttagaa
gtcgcttactggaaaatttgtaaagttgatattaataaaacagcaggagtggtaaactta
aatttcttgaaatttatttcaatgagcacggagatattagatttattgtcaatttcaatc
aaatccattttcttaccattattaaataattcgccagaaattaaagctcagattattgag
atgacaaattcacaaattcaaaagatggaaatacttattaatataattttgcaagagacc
attacggtaatttcgactaaattttccgcaattttgtgcaagcaaaagaagaaggatttt
gtgccaaaatctcaagagctattggatcaagacaccttaccggctattgagattgtcaat
attttaaacttaatctttgaacagtcttccaagtttcttaaaggaaaaaacttacagaca
tttttaacgttgattggggaagagttatacggtttactactgtcacattattcacacttt
caagtcaattccattggcggtgttgtagttacgaaggatatcataggctaccaaactgca
atagaagattggggagtagcgtccttgattgacaaatttgctactttgagagaacttgca
aatctatttactgttcaacctgaattattagaatcactaactaaggagggtcatttagca
gacattggaagggatattattcaaagctacatttccaacagagaggacttcaatcatgac
aatttcattaatagcgttaaattgaattttagatag

Protein sequence

>850863 : length: 871
MNSLYELDPKWKKLLKTDNFLGGLTVNEFVQELSKDHRNDVLIDANTKNLPTNEKDQDAI
REAIWKQLDPKPYIRTFESTLKELKNLNEETLNKRQYFSEQVATQEVIHSENVIKLSKDL
HTTLLTFDKLDDRLTNVTQVVSPLGDKLETAIKKKQNYIQSVELIRRYNDFYSMGKSDIV
EQLRLSKNWKLNLKSVKLMKNLLILSSKLETSSIPKTINTKLVIEKYSEMMENELLENFN
SAYRENNFTKLNEIAIILNNFNGGVNVIQSFINQHDYFIDTKQIDLENEFENVFIKNVKF
KEQLIDFENHSVIIETSMQNLINDVETVIKNESKIVKRVFEEKATHVIQLFIQRVFAQKI
EPRFEVLLRNSLSISNLAYVRILHGLFTLFGKFTKSLIDYFQLLEIDDSNQILSTTLEQC
FADLFSHYLYDRSKYFGIEKRSLEAILVDMTSKFTVNYDKEINKRVLLDKYKEKLSTNVD
AFMHSPRGNTHSRQDSTSRSKLSQFNSFLKTHLDKDHLSLNRTNTLSDSFNNSSSSTQYD
VANNSSSLVNSSFTASDIDNSPNSPANYSLNDVDSMLKCVVESTARVMELIPNKAHLYIL
EILKIMFLGIVDSYMEIALEVAYWKICKVDINKTAGVVNLNFLKFISMSTEILDLLSISI
KSIFLPLLNNSPEIKAQIIEMTNSQIQKMEILINIILQETITVISTKFSAILCKQKKKDF
VPKSQELLDQDTLPAIEIVNILNLIFEQSSKFLKGKNLQTFLTLIGEELYGLLLSHYSHF
QVNSIGGVVVTKDIIGYQTAIEDWGVASLIDKFATLRELANLFTVQPELLESLTKEGHLA
DIGRDIIQSYISNREDFNHDNFINSVKLNFR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min