Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850872, CBF5

Organisms

Yeast (4932)

Synonyms

YLR175W;
Pseudouridine synthase catalytic subunit of box H/ACA small nucleolar ribonucleoprotein particles (snoRNPs), acts on both large and small rRNAs and on snRNA U2

Description

Cbf5p

Xrefs

SGD:S000004165

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 850872 PMID: 16429126
851152 850872 PMID: 16429126

Sequence Information

Nucleotide sequence

>850872 : length: 1452
atgtcaaaggaggatttcgttattaagcctgaagctgcaggtgcttccactgacactagt
gaatggccattacttttgaagaattttgataagttattagtcagaagtggtcattatacc
cctatcccagctggtagttcaccactaaagagagacctgaaatcatatatcagctctggt
gtcattaatctagataaaccttccaacccatcatcgcacgaagttgtagcttggatcaaa
agaatcttacgttgtgagaagactggtcactctggtacattggatccaaaagttacaggt
tgtttgattgtttgtattgacagagctaccaggttggttaagtctcaacaaggtgctggt
aaggagtatgtgtgtattgtcagattgcatgatgctttgaaggatgaaaaggatttgggc
cgctcactagaaaacttgaccggtgcgcttttccaaagacctcctttaatctctgctgtt
aagagacaattacgtgttcgtactatctatgagtcaaacttgattgagttcgataacaag
agaaacttaggtgttttctgggcttcctgtgaagctggtacttatatgcgtactttgtgt
gttcatttaggtatgctattaggtgttggtggtcacatgcaagaattgcgtcgtgttaga
tccggtgctctgtctgaaaatgacaacatggtcactttacatgatgttatggatgcccaa
tgggtttacgacaatacaagagatgaatcttacttgagatccattattcaacctttagaa
actctattggttggttacaagagaattgtagtgaaggattctgctgtcaatgcagtatgt
tatggtgcaaagttgatgatccctggtttattgcgttacgaagaaggtattgagttatat
gacgaaattgtcttgataactaccaagggtgaagccattgccgttgccatcgcacaaatg
tcaaccgttgacttagcttcctgtgatcatggtgttgttgctagtgtgaagagatgtatc
atggaaagagatttatacccaagaagatggggtttgggtccagtcgcacaaaagaagaag
caaatgaaggcagacggcaaattggataaatacggccgtgttaacgaaaacaccccagaa
caatggaaaaaagaatatgttccattagacaatgctgaacagtcaacttctagctctcag
gaaactaaggaaactgaagaagagcctaagaaagctaaagaagattctttaatcaaagaa
gtcgaaactgagaaggaagaagtgaaagaggatgacagcaaaaaggaaaagaaagagaag
aaggacaagaaggaaaagaaggaaaagaaagaaaagaaggacaagaaggaaaagaaagag
aaaaaggagaagaaaagaaagtctgaagacggtgattctgaggaaaagaaatctaagaaa
tctaagaaatga

Protein sequence

>850872 : length: 483
MSKEDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLKRDLKSYISSG
VINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAG
KEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYESNLIEFDNK
RNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGALSENDNMVTLHDVMDAQ
WVYDNTRDESYLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELY
DEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRWGLGPVAQKKK
QMKADGKLDKYGRVNENTPEQWKKEYVPLDNAEQSTSSSQETKETEEEPKKAKEDSLIKE
VETEKEEVKEDDSKKEKKEKKDKKEKKEKKEKKDKKEKKEKKEKKRKSEDGDSEEKKSKK
SKK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min