Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850884, SKG3

Organisms

Yeast (4932)

Synonyms

YLR187W;
Skg3p

Description

Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery, cytoplasm, bud, and bud neck; potential Cdc28p substrate; similar to Caf120p and Skg4p

Xrefs

SGD:S000004177

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 850884 PMID: 16554755

Sequence Information

Nucleotide sequence

>850884 : length: 3081
atgaaaaggattttctctggtgtgaagtccccaaagttatctgctcccccaaaagttttc
aaaaatgatgagagcccatccactccgagctctcccaaattcgaccaagggcttcgaagt
ttatcagcatcagcttcaagactcttcagtaactcaatatccactcctgggagccctacg
ttagatcttccgcaagaacactctattaatggtgatatctcaccagaactagtaccaatc
gttactttactctctgcacaggctcataggagataccattatggtatattcttgatatta
catgatttgaagacagacggaacacctgccgcgcgtcagtgggaagaatgctatggtgtg
ttgctaggaactcagctggctttatgggatgcaaaagaattatcagattccaagaataat
aagaacacatcaaccatgaaaaaagccgcatcgagaccttcttttatcaattttacagat
gcttctgtgaggagtttggacgctaatgatcaggtaatcattgcatcagagaacgaaaag
acaaagaaagatctagacaatgttcttgttgtttcaacaactttaaaaaacaggtatttc
ttaaaattcaaaaattcaaaatcattcaaaacttggaacgcagcaattaggcttagtttg
ttcgagtttacggcgttgcaagaggcctacacgggctcatttttgtcaagcagaggtgtt
aaacttggtgatatcaaagttgttatggcagatacaaaattcacttatgaggactgggtt
agcgtaagattcgggacaggtatgccatggaaacgttgttatgctgttatttctccacag
tctggcaaaaaaaagaaaaattcgaaaggttcaatatgtttctatgaaaataacaaaaaa
accaaaaaatcaaacataatgacaacggtagtagatgcacgggctttatatgccgtttat
ccttcctcgccgatattaatcgacacatctacaatcataaaattggaaggttttgtctct
tttgacaaaagtgaggaacctcaagaaaccaacctatttatcatgcctgaaaagcatcaa
ggtgttccgggatatgacactattattcgcttcttaatcccagctatgaacgcgttctac
ttatatggtaggccaaagggtttgattgccaacagaactgacccagactccctgctgttt
gccttacccactcttccgcatatatattatttgcaggtggatgacgttttatcattaaca
aaagacaaaaattacatacattggagtgctgctgattggaggaataacattgttcaagta
ttacagaaaaaattaagtaagggctataaaggctgtggtaataaaactgtatcagtttca
tctgggatgatgaagtcgccggcaattagttcagctgaattatttgaagggtacgattct
ctccctgaaagacaaatggaaagtccgcaaaaatctaagatgaagtctcctacattagca
tcgaccgatgatattaattccgcttctgcttccgtaaactcacatgctacctcagtaaaa
caaactgaattatttgtgactgataattcttcaaaaatcaatgactctgtgtcggcgcag
tccagtgtcactactaacttcaaagatacttttaccaccccaatgacatcaggaatgctc
aaccatgaaaattcagagagaagctttggttcaggattaaaactcaaaatcactgattca
aatttggaaaatatggaagacgttgaagcgaaatctgctaacgaattctctacgacacca
gaagacaaacatattcacctcgccaatgcagccgaattatccgccctttacgacaaatat
tccacatctccgtttggtaaatcggaggctaattcaagccctaaacctcaaaaattggaa
gttaaagatcggtcaaaaaatgaaaacagaagcccctatgagagatacgtaggtacatcc
gctgaaagcaagacatttgaaataggtaacgtcagagagtcgaaaagtacgataaatact
tccctttcttcgcctttgagggtagaagatagtagacgttcaaaaaatgaggacctggga
tctttgaaagagtttgaagagttatctcaaaagattagcaatatgggaatggcaaatatt
tcttcagaagctttaagtgacacagcagaaaacagttcttttgttacggacctgaacttg
aatatcaataacagttcatcggtcaatctcaatgaagaacaacgtgtgccggattttggg
gaggaaaacgtatttgatccagattatatggaacaaaaccaaatgttggaaacagaaagt
aggtacactacggatgagtttgacttttcagataatcaggatgcagcatccagtaattat
agcaatgggcaaaccaaccgaacagtaactgaaaccctttctgccagtgacagaaatgac
aagatcccacattcttctttatttacaaacttaaaccagcttacttcgaatggaggaaac
tatcaggatagggaagatttctctggtgatcaaataaacaaacctcaacaatctcaacca
cttcatgtgaaaggaccacaaacttcgtcatttggttacagaaattcttcagccaatagc
tcgcagcctcaagcaccatacccggttggtcgcccgttaggtaagataagaacgggtccg
ctgaccgtccagcctatgcaacaaggtggaaactcatcaatgtattctttccaatcttcg
caacatcggtttcattcgtcgcaacagcgccaaaaccaatcactttccttcagaaacaat
acctatggaagtggtaacaatcaaaatacattccatccatcgccgcaactgcaacaacag
cctcaaaatatgagatatttgaataataagttaccaataaatgatagatctccaataccg
caaacacagcaccatgtaccagatggccgtcccagcctccatataaataccactaaccgc
acaaatccgcttactgcacaaagtggattttctcaatttatgcctcccaatagcacatca
accaacccatattccagctga

Protein sequence

>850884 : length: 1026
MKRIFSGVKSPKLSAPPKVFKNDESPSTPSSPKFDQGLRSLSASASRLFSNSISTPGSPT
LDLPQEHSINGDISPELVPIVTLLSAQAHRRYHYGIFLILHDLKTDGTPAARQWEECYGV
LLGTQLALWDAKELSDSKNNKNTSTMKKAASRPSFINFTDASVRSLDANDQVIIASENEK
TKKDLDNVLVVSTTLKNRYFLKFKNSKSFKTWNAAIRLSLFEFTALQEAYTGSFLSSRGV
KLGDIKVVMADTKFTYEDWVSVRFGTGMPWKRCYAVISPQSGKKKKNSKGSICFYENNKK
TKKSNIMTTVVDARALYAVYPSSPILIDTSTIIKLEGFVSFDKSEEPQETNLFIMPEKHQ
GVPGYDTIIRFLIPAMNAFYLYGRPKGLIANRTDPDSLLFALPTLPHIYYLQVDDVLSLT
KDKNYIHWSAADWRNNIVQVLQKKLSKGYKGCGNKTVSVSSGMMKSPAISSAELFEGYDS
LPERQMESPQKSKMKSPTLASTDDINSASASVNSHATSVKQTELFVTDNSSKINDSVSAQ
SSVTTNFKDTFTTPMTSGMLNHENSERSFGSGLKLKITDSNLENMEDVEAKSANEFSTTP
EDKHIHLANAAELSALYDKYSTSPFGKSEANSSPKPQKLEVKDRSKNENRSPYERYVGTS
AESKTFEIGNVRESKSTINTSLSSPLRVEDSRRSKNEDLGSLKEFEELSQKISNMGMANI
SSEALSDTAENSSFVTDLNLNINNSSSVNLNEEQRVPDFGEENVFDPDYMEQNQMLETES
RYTTDEFDFSDNQDAASSNYSNGQTNRTVTETLSASDRNDKIPHSSLFTNLNQLTSNGGN
YQDREDFSGDQINKPQQSQPLHVKGPQTSSFGYRNSSANSSQPQAPYPVGRPLGKIRTGP
LTVQPMQQGGNSSMYSFQSSQHRFHSSQQRQNQSLSFRNNTYGSGNNQNTFHPSPQLQQQ
PQNMRYLNNKLPINDRSPIPQTQHHVPDGRPSLHINTTNRTNPLTAQSGFSQFMPPNSTS
TNPYSS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min