Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

850894, SIK1

Organisms

Yeast (4932)

Synonyms

YLR197W;
NOP56;
Sik1p

Description

Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects

Xrefs

SGD:S000004187

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 850894 PMID: 16554755

Sequence Information

Nucleotide sequence

>850894 : length: 1515
atggctcctattgaatacctactgtttgaagaacctactggttacgcagttttcaaggtt
aagttgcaacaagatgacattggttcaagattaaaagaagttcaagagcaaatcaatgat
tttggtgcttttacaaagttaatcgaacttgtatctttcgcgccattcaaaggtgctgct
gaagcccttgaaaatgctaacgacatatcagaaggtttagtctctgagagtttgaaagct
atcttggatttaaacttaccaaaggcttcctcgaaaaagaagaacattactttggctatt
tccgataaaaacttaggtccttctattaaggaagaatttccatatgttgattgtatttca
aatgaacttgctcaggatttgattcgtggtgtcagattacatggcgaaaaattattcaaa
ggtctacaatctggtgacttagaaagagcccaattaggtttaggtcacgcttactccaga
gctaaagtgaagttctctgttcaaaagaacgacaatcacatcattcaagctattgcttta
ttagatcaattagataaagatatcaacacttttgctatgagagttaaagagtggtatggc
tggcatttccccgaactggctaaattggtaccagacaactacacttttgccaagttggtt
ctttttatcaaggacaaagcttcattaaacgatgactccttacatgatttggctgctctt
ttgaatgaggattcgggaattgcacaaagagtcattgacaatgcccgtatctccatggga
caagatatatcagaaaccgatatggaaaatgtttgtgttttcgctcagagagtcgcttcc
ttagctgattacagaagacaattatacgattacttatgcgaaaaaatgcacactgttgca
ccaaacttatcagaattgattggtgaagtgattggtgctagattaatttctcacgcaggt
tccctaactaatttatctaagcaagcagcttcaacggttcaaattcttggtgctgaaaag
gctttgttcagagctttaaaaactaaaggtaacactccaaaatacggtttgatttaccac
agtggttttatttctaaggcctctgccaagaacaagggtcgtatttctagatacttggct
aacaaatgttctatggcctctagaattgacaattactctgaggaaccatctaatgttttt
ggttccgtactaaagaaacaagttgagcaaagattagaattctacaacactggtaagcca
actttgaagaatgaattagccattcaagaagccatggaactttataacaaagataaacca
gctgcagaagtggaagaaaccaaggaaaaggaatcctcaaagaagagaaaattagaagat
gatgatgaagaaaagaaggaaaagaaagagaaaaaatcgaagaaggaaaagaaagaaaag
aaggaaaagaaggacaaaaaggaaaagaaagataaaaaggaaaagaaggataaaaagaag
aaaagtaaggattaa

Protein sequence

>850894 : length: 504
MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA
EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS
NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL
LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA
PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP
TLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEK
KEKKDKKEKKDKKEKKDKKKKSKD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min