Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851025, NKP2

Organisms

Yeast (4932)

Synonyms

YLR315W;
Non-essential kinetochore protein, subunit of the Ctf19 central kinetochore complex (Ctf19p-Mcm21p-Okp1p-Mcm22p-Mcm16p-Ctf3p-Chl4p-Mcm19p-Nkp1p-Nkp2p-Ame1p-Mtw1p)

Description

Nkp2p

Xrefs

SGD:S000004307

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 851025 PMID: 18467557
851152 851025 PMID: 18467557

Sequence Information

Nucleotide sequence

>851025 : length: 462
atgaactctgaacagctgctgcataactatgtttcggattcgctactcactactctgata
agttttcaagagttcaagcagcaactacagtcgtacacgagcgacgagcaacaactgcaa
cattggtacgaattgcttcaggccagggatgcgcgagtgacctctgagttagaagcacga
atcaagcagtttttcataacgttgcgctctagattactgcgatttctggaaagcgagcaa
ctatcacactcccttagcctcgagacactgatcgacgcgctgtacaagattaatgacctg
ttgcaacagcgtttgcagattctggatgatgctattcaggaaaagacctcggaactagca
gaatttgaaaatatggttcgctcaccgagtgcaggagacaatgccattcctggcctatta
caaattatacaatcttatattaatctattagaggaaaactag

Protein sequence

>851025 : length: 153
MNSEQLLHNYVSDSLLTTLISFQEFKQQLQSYTSDEQQLQHWYELLQARDARVTSELEAR
IKQFFITLRSRLLRFLESEQLSHSLSLETLIDALYKINDLLQQRLQILDDAIQEKTSELA
EFENMVRSPSAGDNAIPGLLQIIQSYINLLEEN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min