Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851030, MMS22

Organisms

Yeast (4932)

Synonyms

YLR320W;
SLM2;
Protein involved in resistance to ionizing radiation; acts with Mms1p in a repair pathway that may be involved in resolving replication intermediates or preventing the damage caused by blocked replication forks

Description

Mms22p

Xrefs

SGD:S000004312

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851030 PMID: 16554755

Sequence Information

Nucleotide sequence

>851030 : length: 4365
atggatgttgatgaaccgaatcctattgtgatatcagattctgaggccactgatgaggaa
attagtatcatatacgaacccgaattcaatgaaaattatttatgggcagaggaaaacgtc
caagaagcaagcagatcacagaaaattgtcactgagaggttgagcctggattccactgct
ggagaatcttgtactccttccgtagtaactgatacacaagttactacggggcttcggtgg
tctttgaggaagaggaaggctattcaaaagatgccatacagtttagaacgcataaagcat
aggcagttgctagagggctatgatatctctagttttgacagcatttcgaatcagttgacc
ttaccgaagaacgcttctacagtgattcactcaaatgatattttacttacaaagagaact
ggtaaacccttagatgagcagaaagatgttacaatcgactccattaaacccgaaaacagc
tcggttcaatctcaaagatatgatagtgatgaagaaataccaaagaaaaggcatcgtact
tttaaagacctcgaccaggatatagtatttcaatcaggtgattctacggaagatgaacaa
gacttggctagtacaaatttacagaatactcaaaatgacgaagtaatatttagaggaaga
gtattgaatgtaagaactggttaccgtggggtcctgccaagagttgcttgggaaaagtcg
ttgcaaaagcagcagtcttcaaaagtcacgaaaagaaaaactcaattattgaaccataag
ggtgtggctaagaggaaaatgaacagaagcgcccatattgaagatgaagaacagaactta
ttgaacgatcttattgcacctgatgacgaactggatatcgaggaaaacgcccctccagat
atatacttaggaaatcttccagaggatcgtgaggctaacgaaaaggaattaaaggaattg
caagaatattatgagagcaagtatagtgaagacgcacaatcggctggaacttctggtttt
aatttaaatgaggaataccgcaatgaaccagtgtatgagctggaatatgacggaccgggg
agctgcatatcacatgtgtcttataaagaccagcctattatttatttgaattcacggcat
tcagatagcggatttagtgagcaatacaatatatctgccgaagataatcaaagtgtaatt
tccctagatgctgctgaagagcataacgatggtataattgacaagatgttggttaaacct
aaaagaattaaagcaaccaatgatgccaactttttgaatacaaaaagtaagagagtgaga
agatataagtacaaatatcgaaattcttgtctggccccaagtacaaaagctatcaaagtc
ggaaaacggtcagcgcataaatctcatttggcagctaataatccagtttcatttgtttct
aagaagaatcatgtaattgatgattatttttttgaagaattagaatctcaatccctagaa
caggatgacagctcttctctcaagccacagaaaaaaagaaggaagaagaaagcacctata
tactcaagtttctccgctgatcttgaatcgagacgaaaaccagttttcaatactgttgta
gaggttcccacgaaccgatacgctttcacaaagccaaatgtacgtaatagggacagcatt
aatcatgacatggaatttgaggaagaagactccaatcaagagcttggaccaataatggtc
gtacttgactcaattttactaaaaaaaccttttgagccacctaatttcttcaagatccag
ttgtcagacaagagtttcttgctatcaaaattgaatcctgcagatatagctacatcatta
cagaaaatattcagagtaatcattgataaaggtatcactgatactgaactagttcacttt
aacgaaagccttattgcttttttggtgcaccttgacatgcctgaactattcgacttaata
ggtgaatttcatcgtgaatttagatcgaaggtcaatagcttgaggaaaaaagctaaacca
atccatttttttcaaattgcggcatgccaattaatgtttctagaaatatcaagatataac
aaaatttcagccgctgcaaaattcgacatggatgtcaaactcttagatcatattgtgtct
ttcttcaaattactttctgtctgttatgattctgttatgaaaaatccaatgcaatatctg
tacacaagttattatattctctctgctgtcgttgatgtcatacataaaaaggaagctttg
tgggatttatttcaaaagcaccccttttcgcctcatatttcactgttgctggtcaacata
tttcctacgaaagtctgccgctggcaggttttgagattagattctgaattccaacccttg
agttcggcatttcggttcatcaattattgcattgagacttgtaattggaatgttacaaat
tctttgattctttctctcgatcgcatattcaaacggagaagattttcggactttgaagaa
gagtctgatttgtcacaaaacaataagataatttatcctccaacgaatcagcttacgagt
cgattaatgtttaacagatatttgcatctactgacgttgtgtgaattgtctagttctgat
acacaacgtgtgataccgatgggtgatatttctatgaatgattctctatctgttttgaag
aaccgcctcaacctactaattgttctagctacacgttttgatttaaacttagagaagcgc
ttccaagagctaacacgaccgttatatagtaaggaatatttaaacttgcatacacagaac
acagtcaggacgataacaacattgatcatgcaggccagcctttcattcctggaaatcagt
cgaatcaaaaatcatccattcagtggaaaatttattgcgtcattatttgataaactagta
cttcaacaaccttccatatcgggagtaacagaaaattttttgaaagaattcacaaattta
gtctccaaaatgaaaagaaaaagcgtgagtatgctcaaatttctgtatccttcactggtg
gccatgtctcaagaaaatatattcgagtcgtctttttttttattattacaggtatatttg
aagagcttagatgtgctgggtccaacttgggtgcaaaattatctttttcagtttataaag
agcaaggctcaagaaaatgaaagatggatagaatgctattgtcagatcggaaaattcctc
gtagattctggtatatttacctggtggactttctttacctataacggcttagatgctgca
ttacactttcagcttgcatttcactcccttattatcgatttctgtgatacagactctttt
gaattactgaaaaaaccgctttattccattgcttctgatttgctgctcatttccaaagat
gacgctttctatcactttctttccaatctgttgaagagggcacatatcatagtagcagat
ttgaaacctgtttccgatgagaatgaactcctgcgattggcttatattttttctaaagca
ttgaaaaaaaatgcatatcaagatctattagctgttttcttatccctggcgaaaaaacat
tacgatgaaggggacatcagtagaaatttcttggcaaaatatctcgaatttcttaacaaa
aattgcttgactgagctaagaaataatcaactcttcatcagtctaagaagggaacttggt
atttcaagtgatgaagacgaaaaatgtgcgttctgggactcattcaatgaagcaggtgat
atactttccaaagctgcatttgttgaaaccggtattgttcaagcctgttgcactgggaat
gaaattgatggatatcttgacaatttaagcactttattcacctccaccatgttagagagc
ccttttgcatttttttctgacctggtgatagcacacatatttgagaacagaccttttttc
gacgtgaatatcaagaattttcttctatctcacttcatagaccttttcaacaaggtttta
aaaatgaaattcgagcaggtatctcctgatgaatttgctgaactttgcaaagtatacagg
gcgttatgtattgagtgcgcaacagacgacacctttaatagtaatagtgatttgatcgcc
gcaaaagatgcgtttttggtatctgtgttgagaatcgcagatgggttttgggagcatgac
aaacttttgcagctaaggatgcttgatagtaatatgaacatacctaatcagattcctcat
actactttgcaaagttcgctatctgcgattgtaataaagataatagaaagtaatatagga
aaaattgaggcgtctgaacctttcaaaaccttcaagaatacgtaa

Protein sequence

>851030 : length: 1454
MDVDEPNPIVISDSEATDEEISIIYEPEFNENYLWAEENVQEASRSQKIVTERLSLDSTA
GESCTPSVVTDTQVTTGLRWSLRKRKAIQKMPYSLERIKHRQLLEGYDISSFDSISNQLT
LPKNASTVIHSNDILLTKRTGKPLDEQKDVTIDSIKPENSSVQSQRYDSDEEIPKKRHRT
FKDLDQDIVFQSGDSTEDEQDLASTNLQNTQNDEVIFRGRVLNVRTGYRGVLPRVAWEKS
LQKQQSSKVTKRKTQLLNHKGVAKRKMNRSAHIEDEEQNLLNDLIAPDDELDIEENAPPD
IYLGNLPEDREANEKELKELQEYYESKYSEDAQSAGTSGFNLNEEYRNEPVYELEYDGPG
SCISHVSYKDQPIIYLNSRHSDSGFSEQYNISAEDNQSVISLDAAEEHNDGIIDKMLVKP
KRIKATNDANFLNTKSKRVRRYKYKYRNSCLAPSTKAIKVGKRSAHKSHLAANNPVSFVS
KKNHVIDDYFFEELESQSLEQDDSSSLKPQKKRRKKKAPIYSSFSADLESRRKPVFNTVV
EVPTNRYAFTKPNVRNRDSINHDMEFEEEDSNQELGPIMVVLDSILLKKPFEPPNFFKIQ
LSDKSFLLSKLNPADIATSLQKIFRVIIDKGITDTELVHFNESLIAFLVHLDMPELFDLI
GEFHREFRSKVNSLRKKAKPIHFFQIAACQLMFLEISRYNKISAAAKFDMDVKLLDHIVS
FFKLLSVCYDSVMKNPMQYLYTSYYILSAVVDVIHKKEALWDLFQKHPFSPHISLLLVNI
FPTKVCRWQVLRLDSEFQPLSSAFRFINYCIETCNWNVTNSLILSLDRIFKRRRFSDFEE
ESDLSQNNKIIYPPTNQLTSRLMFNRYLHLLTLCELSSSDTQRVIPMGDISMNDSLSVLK
NRLNLLIVLATRFDLNLEKRFQELTRPLYSKEYLNLHTQNTVRTITTLIMQASLSFLEIS
RIKNHPFSGKFIASLFDKLVLQQPSISGVTENFLKEFTNLVSKMKRKSVSMLKFLYPSLV
AMSQENIFESSFFLLLQVYLKSLDVLGPTWVQNYLFQFIKSKAQENERWIECYCQIGKFL
VDSGIFTWWTFFTYNGLDAALHFQLAFHSLIIDFCDTDSFELLKKPLYSIASDLLLISKD
DAFYHFLSNLLKRAHIIVADLKPVSDENELLRLAYIFSKALKKNAYQDLLAVFLSLAKKH
YDEGDISRNFLAKYLEFLNKNCLTELRNNQLFISLRRELGISSDEDEKCAFWDSFNEAGD
ILSKAAFVETGIVQACCTGNEIDGYLDNLSTLFTSTMLESPFAFFSDLVIAHIFENRPFF
DVNIKNFLLSHFIDLFNKVLKMKFEQVSPDEFAELCKVYRALCIECATDDTFNSNSDLIA
AKDAFLVSVLRIADGFWEHDKLLQLRMLDSNMNIPNQIPHTTLQSSLSAIVIKIIESNIG
KIEASEPFKTFKNT



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min