Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851052, RPP0

Organisms

Yeast (4932)

Synonyms

YLR340W;
RPL10E;
Rpp0p

Description

Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302

Xrefs

SGD:S000004332

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851052 PMID: 16429126

Sequence Information

Nucleotide sequence

>851052 : length: 939
atgggaggcattcgtgaaaagaaagctgaatactttgctaaattaagagaatacttggaa
gaatacaagtctttgttcgttgttggtgttgacaatgtttcttcccaacaaatgcacgaa
gtcagaaaggaattgagaggcagagctgtcgtcttgatgggtaagaacaccatggttaga
agagccatcagaggtttcttatccgacttgccagacttcgaaaagttgttgccttttgtc
aaaggtaacgttggtttcgttttcactaacgaaccattgactgaaatcaagaacgttatt
gtctctaacagagttgctgctccagccagagctggtgccgttgctccagaagacatctgg
gttagagccgtcaacactggtatggaaccaggtaagacttctttcttccaagctttgggt
gtcccaaccaagattgccagaggtaccattgaaattgtttctgatgtcaaggtcgttgac
gccggtaacaaggtcggtcaatctgaagcttccttgttgaacttgttgaacatctctcca
ttcactttcggtttgactgttgttcaagtttacgacaacggtcaagtgttcccatcttct
atcttggatatcaccgatgaagaattggtttctcacttcgtttccgctgtcagcaccatt
gcttctatctctttggctattggttacccaaccttgccatctgtcggtcacactttgatc
aacaactacaaggacttgttagctgttgccattgctgcttcctaccactaccctgaaatt
gaagatttggttgacagaattgaaaacccagaaaagtacgctgctgctgctccagctgct
acctccgctgcttccggtgacgctgctccagctgaagaagctgctgctgaagaagaagaa
gaatctgatgacgacatgggtttcggtttattcgattaa

Protein sequence

>851052 : length: 312
MGGIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVR
RAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIW
VRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISP
FTFGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIASISLAIGYPTLPSVGHTLI
NNYKDLLAVAIAASYHYPEIEDLVDRIENPEKYAAAAPAATSAASGDAAPAEEAAAEEEE
ESDDDMGFGLFD



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min