Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851082, RPS22B

Organisms

Yeast (4932)

Synonyms

YLR367W;
Rps22bp

Description

Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins

Xrefs

SGD:S000004359| SGD:S000006504

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851082 PMID: 16429126

Sequence Information

Nucleotide sequence

>851082 : length: 393
atgactcgctcttccgttttagctgatgctttgaatgccattaataacgccgaaaagacc
ggtaaacgtcaggttctattgagaccttcttccaaggttatcatcaagtttttacaagtt
atgcaaaagcatggttacattggcgaattcgaatacattgacgaccacagatctggtaag
attgtcgtccaactgaacggtagattgaacaaatgtggtgttatttccccaagatttaac
gttaagattggtgacattgaaaaatggaccgccaacttattgccagccagacaattcggt
tacgttattttgactacttctgcgggtattatggaccatgaggaagctagaagaaagcac
gtttccggtaaaatcttgggttttgtctattaa

Protein sequence

>851082 : length: 130
MTRSSVLADALNAINNAEKTGKRQVLLRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGK
IVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKH
VSGKILGFVY



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min