Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851147, MAG2

Organisms

Yeast (4932)

Synonyms

YLR427W;
Mag2p

Description

Cytoplasmic protein of unknown function predicted to encode a DNA-3-methyladenine glycosidase II that catalyzes the hydrolysis of alkylated DNA

Xrefs

SGD:S000004419

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851147 PMID: 11805837
854948 851147 PMID: 11805837
851152 851147 PMID: 11805837

Sequence Information

Nucleotide sequence

>851147 : length: 2013
atggtagaaccggacatgcagaagaaggcaagtggtggcagtggcggttccgagatggat
actttaaatgctaccagcaacagtagtaaacaaggagtttcaaataataaaaggaatccg
gtcagtaaaaagaaaccagggaataaggtctctgatggaagagataatgcacataattat
cacggggaaggccgcagaaaaagtagcaaacaacagaggtcaagaacgccctataaggag
actagtactaggatcaatgatcaagatatagatttatctatccaggaagaaattcttggt
ggtaatttcaaattacgaggcaggaaaactcaagtttccattaatcatttgttgaatttc
cagttacctgaagtcgaaagggaaaaaagtaggtcctcttcaagtaagaaatcgaatagg
agacgcgatgagcacgtacatttacacggtgacacatttgttaatgttaattaccgtctt
ttggtagatgatcgttttgactacccagagcaaaactgtaacccgaacgttcctgtcgat
caagaaaagattctaagagtcatagtgccaaagggtcagaattgttctatttgtctgagc
gaggaaccggtggctcccagaatggttacttgtggccatattttctgtctaagttgtctc
ttgaactttttctccattgaagaaaccgtcaaaaataaagagactgggtactcaaagaag
aagaaatataaagaatgcccgctttgtggaagtattattggccctaaaagggtcaagcct
gttctgtatgaggacgactttgatgtaaccaggttaaatcaaaaacccgaacctggtgcc
acagtacatctacaactgatgtgtaaaccacacggttcactattacctttgccagtagcc
ttacatttagaccctctaaaatgtggaaatttccctcccgcaaacttaggatcaataaag
cattatgcgcatattatgaagtgtggcgtgtcttactccttggagctctatcaaaaggac
attgttgctattcaggaacaatatgaaatcgacaaggccatttataatgatagtggaaaa
tttgttaagcagtcgattgaaaatatcaatgatcaaatttcgacgttgctggctgcaacc
actgatttgagcccactttccaacgatattaacaacggtttggacaattttcattttgat
gacgatctcttgaccaaatacgatgattcttccgcttattttttctaccagacgttggtg
gcatcgtccacgaaatacttcttatctccactggatgtaaaaatcttattgactattttc
cactattattccaagtttccagaaagcatcgagacgacagtcgaaaatatacattatgat
acagtggtaacggagcaattaatccgccgctacaagtacatcggccaccttccaatcggc
actgagattgcccttttagacttggactggcgtaaaataccattccttcccaaggaaatt
tacgaacagtttgctcatgagctaaaacaacgtcgaagaaaattcacaatgaaaaagcaa
aaggaagataaggaaaagaaactatatgaaaaaaggttggaacaagaacatgccgagttc
tacagaaaggaaaatggcaattctctcaagtttgaagactctgtacagatggctacccat
tatgaatccattgtaagctcttccatacctctcaactccttaggaatttctatgctgggt
ccaccgacaaattcctgctctactcctcaaaagcaagcgccctcccacacgaaaagaaca
atttgggggacatcaattgcagtgacggaagacgaaaaagcatcaaaggagaacaaagaa
tttcaagatatgttattgcagcgaataaggcaggaagatagttcggatgtcacagattcg
acggattctcctcctacaagtaatggtaagcgaggcaggaagaagaaaggtaaagtcatg
ctattcagcagcaatcatcaagccttgggttag

Protein sequence

>851147 : length: 670
MVEPDMQKKASGGSGGSEMDTLNATSNSSKQGVSNNKRNPVSKKKPGNKVSDGRDNAHNY
HGEGRRKSSKQQRSRTPYKETSTRINDQDIDLSIQEEILGGNFKLRGRKTQVSINHLLNF
QLPEVEREKSRSSSSKKSNRRRDEHVHLHGDTFVNVNYRLLVDDRFDYPEQNCNPNVPVD
QEKILRVIVPKGQNCSICLSEEPVAPRMVTCGHIFCLSCLLNFFSIEETVKNKETGYSKK
KKYKECPLCGSIIGPKRVKPVLYEDDFDVTRLNQKPEPGATVHLQLMCKPHGSLLPLPVA
LHLDPLKCGNFPPANLGSIKHYAHIMKCGVSYSLELYQKDIVAIQEQYEIDKAIYNDSGK
FVKQSIENINDQISTLLAATTDLSPLSNDINNGLDNFHFDDDLLTKYDDSSAYFFYQTLV
ASSTKYFLSPLDVKILLTIFHYYSKFPESIETTVENIHYDTVVTEQLIRRYKYIGHLPIG
TEIALLDLDWRKIPFLPKEIYEQFAHELKQRRRKFTMKKQKEDKEKKLYEKRLEQEHAEF
YRKENGNSLKFEDSVQMATHYESIVSSSIPLNSLGISMLGPPTNSCSTPQKQAPSHTKRT
IWGTSIAVTEDEKASKENKEFQDMLLQRIRQEDSSDVTDSTDSPPTSNGKRGRKKKGKVM
LFSSNHQALG



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min