Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851152, IMD3

Organisms

Yeast (4932)

Synonyms

YLR432W;
Inosine monophosphate dehydrogenase, catalyzes the first step of GMP biosynthesis, member of a four-gene family in S. cerevisiae, constitutively expressed

Description

Imd3p

Xrefs

SGD:S000004424

Chromosome

XII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851152 PMID: 14759368
856626 851152 PMID: 16429126
856626 851152 PMID: 12746440
856626 851152 PMID: 17200106
856626 851152 PMID: 16554755
854948 851152 PMID: 14759368
854948 851152 PMID: 16429126
854948 851152 PMID: 18467557
854948 851152 PMID: 17200106
854948 851152 PMID: 16554755
851152 851874 PMID: 16554755
851152 851030 PMID: 16554755
851152 851152 PMID: 14759368
851152 851152 PMID: 18467557
851152 852248 PMID: 16429126
851152 855881 PMID: 16554755
851152 852702 PMID: 16429126
851152 854034 PMID: 11805837
851152 856384 PMID: 16554755
851152 853610 PMID: 16429126
851152 853419 PMID: 16429126
851152 851636 PMID: 17200106
851152 853128 PMID: 16429126
851152 851906 PMID: 16429126
851152 852218 PMID: 16429126
851152 853896 PMID: 10688190
851152 852245 PMID: 16429126
851152 850346 PMID: 16429126
851152 850346 PMID: 17200106
851152 850346 PMID: 11805837
851152 850682 PMID: 16429126
851152 850682 PMID: 17200106
851152 851716 PMID: 16429126
851152 852487 PMID: 16429126
851152 852757 PMID: 16429126
851152 855547 PMID: 11805837
851152 853531 PMID: 16429126
851152 854768 PMID: 16554755
851152 854392 PMID: 16429126
851152 851311 PMID: 10688190
851152 856912 PMID: 16429126
851152 856626 PMID: 14759368
851152 856626 PMID: 16429126
851152 856626 PMID: 12746440
851152 856626 PMID: 17200106
851152 856626 PMID: 16554755
851152 852080 PMID: 10688190
851152 854940 PMID: 16429126
851152 850691 PMID: 16429126
851152 853071 PMID: 16429126
851152 856572 PMID: 16429126
851152 855972 PMID: 16429126
851152 855972 PMID: 17200106
851152 856885 PMID: 11805837
851152 856610 PMID: 17200106
851152 850590 PMID: 16429126
851152 854026 PMID: 16429126
851152 852976 PMID: 17200106
851152 851745 PMID: 10688190
851152 850872 PMID: 16429126
851152 854542 PMID: 16554755
851152 851025 PMID: 18467557
851152 850894 PMID: 16554755
851152 851665 PMID: 16429126
851152 850737 PMID: 16429126
851152 855357 PMID: 16429126
851152 850623 PMID: 11804584
851152 852804 PMID: 16429126
851152 852804 PMID: 17200106
851152 851082 PMID: 16429126
851152 851814 PMID: 16429126
851152 856776 PMID: 16554755
851152 855903 PMID: 16429126
851152 855903 PMID: 17200106
851152 855708 PMID: 16429126
851152 855543 PMID: 17200106
851152 851313 PMID: 11805837
851152 852838 PMID: 16429126
851152 853718 PMID: 14769921
851152 855658 PMID: 16554755
851152 853397 PMID: 14759368
851152 852344 PMID: 11805837
851152 852283 PMID: 16429126
851152 856305 PMID: 16429126
851152 856305 PMID: 16554755
851152 851196 PMID: 16429126
851152 851699 PMID: 16429126
851152 856890 PMID: 16554755
851152 850716 PMID: 17200106
851152 854902 PMID: 17200106
851152 853152 PMID: 16554755
851152 851147 PMID: 11805837
851152 854417 PMID: 16429126
851152 855491 PMID: 11805837
851152 851969 PMID: 11805837
851152 851052 PMID: 16429126
851152 855335 PMID: 17200106
851152 850884 PMID: 16554755
851152 850863 PMID: 16624861
851152 852194 PMID: 16429126
851152 856351 PMID: 16429126
851152 856351 PMID: 17456744
851152 854948 PMID: 14759368
851152 854948 PMID: 16429126
851152 854948 PMID: 18467557
851152 854948 PMID: 17200106
851152 854948 PMID: 16554755

Sequence Information

Nucleotide sequence

>851152 : length: 1572
atggccgccgttagagactacaagactgccttggaattcgccaagagcttaccaagacta
gatggtttgtctgtccaggagttgatggactccaagaccagaggtgggttgacttataac
gactttttggttttgccaggtctggttgatttcccatcttctgaagttagcctacaaact
aagttgacaaggaatatcactttgaacaccccattcgtttcctctccaatggacaccgtg
acagaatcagaaatggccatcttcatggctttgttgggtggtatcggttttattcaccac
aactgtaccccagaggaccaagctgacatggtcagaagagtcaagaactatgaaaatggg
tttattaacaaccctatagtgatttccccaactactactgtgggtgaagctaagagtatg
aaggaaagatttggattttccggtttccccgttacagaagatggtaaaagaaacggaaaa
ttgatgggtatcgtcacttctcgtgatattcagttcgttgaagacaactctttgcttgtt
caagatgttatgaccaaaaaccctgtcaccggtgcacaaggtattacattgtctgaaggt
aatgaaattttaaagaagattaaaaagggtaagctattgattgttgacgacaatggtaac
ttagtttctatgctttccagaactgatttaatgaaaaatcagaactatccattggcttct
aaatctgccaccaccaagcaactgttatgtggtgctgctatcggtactatcgatgctgat
aaggaaaggttaagactattagtcgaagcaggtttggatgttgttatcttagattcctct
caaggtaactctattttccaattgaacatgatcaaatggattaaagaaactttcccagat
ttggaaatcattgctggtaacgttgccaccagagaacaagctgctaacttgattgctgcc
ggtgccgatggtttaagaattggtatgggttcaggctctatttgtatcactcaagaagtt
atggcctgtggtagaccacaaggtacagccgtctacaacgtgtgtgaatttgctaaccaa
ttcggtattccatgtatggctgatggtggtgttcaaaacattggtcatattaccaaagct
ttggctcttggttcttctactgttatgatgggtggtatgttagctggtactactgaatct
cctggtgaatatttctatcaagatggtaaaagattgaaggcatatcgtggtatgggttcc
attgacgccatgcaaaagactggtactaaaggtaatgcatctacctcccgttacttttcc
gaatcagacagtgttttggtcgcacaaggtgtctccggtgctgtcgttgacaaaggttct
atcaagaaatttattccatatttgtacaacggtttacaacattcttgtcaagacattggt
tacaagtccctaactttattaaaggaaaatgtccaaagcggtaaagttagatttgaattt
agaaccgcttctgctcaactagaaggtggtgttcataacttacattcttacgaaaagcgt
ttacataactaa

Protein sequence

>851152 : length: 523
MAAVRDYKTALEFAKSLPRLDGLSVQELMDSKTRGGLTYNDFLVLPGLVDFPSSEVSLQT
KLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHHNCTPEDQADMVRRVKNYENG
FINNPIVISPTTTVGEAKSMKERFGFSGFPVTEDGKRNGKLMGIVTSRDIQFVEDNSLLV
QDVMTKNPVTGAQGITLSEGNEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLAS
KSATTKQLLCGAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPD
LEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVCEFANQ
FGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGS
IDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIG
YKSLTLLKENVQSGKVRFEFRTASAQLEGGVHNLHSYEKRLHN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min