Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851196, FUN12

Organisms

Yeast (4932)

Synonyms

YAL035W;
yIF2;
GTPase, required for general translation initiation by promoting Met-tRNAiMet binding to ribosomes and ribosomal subunit joining; homolog of bacterial IF2

Description

Fun12p

Xrefs

SGD:S000000033

Chromosome

I : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851196 PMID: 16429126
851152 851196 PMID: 16429126

Sequence Information

Nucleotide sequence

>851196 : length: 3009
atggcgaaaaagagtaaaaagaaccaacagaactactgggatgaggaattcgaagaagac
gccgcccagaacgaagaaatcagtgccacgccaactccaaatccagaaagcagcgcaggt
gcagatgacacttccagagaagcaagtgcaagtgctgaaggtgctgaggccattgaaggc
gacttcatgtctactttgaagcaatcgaagaagaagcaagaaaagaaggttattgaagag
aagaaggatggtaagcctatactaaagtccaagaaggaaaaggagaaggaaaaaaaggaa
aaggagaagcagaagaagaaagaacaagctgccaggaagaaggcccaacagcaagctcaa
aaggagaagaacaaggagttgaacaagcaaaatgttgaaaaagctgctgctgagaaggct
gctgctgagaaatcccaaaaatctaaaggtgaaagtgataaaccaagtgctagtgctaag
aagccagccaagaaagtacctgccggtttggctgctttgagacgtcaattagaattgaag
aaacaacttgaagaacaagaaaagttggaaagagaggaagaagaaagattggagaaagaa
gaggaggaaagattggccaacgaagaaaaaatgaaggaagaagctaaagcagctaaaaag
gaaaaggagaaggcaaagcgtgaaaaacgaaaggctgaaggtaagctattgaccagaaag
caaaaagaagaaaagaaattattggaaagaagacgtgccgctttattgtcttccggtaac
gtcaaagttgccggtctggccaagaaggatggagaagaaaacaaaccaaagaaggttgtt
tacagcaagaagaagaagagaacaacccaggaaaacgcctccgaagccattaaatctgac
tctaagaaagactcggaagttgtacctgatgacgaactcaaagaatccgaagatgttttg
attgatgattgggaaaatttggctcttggtgatgatgacgaggagggaaccaacgaagaa
acgcaagaatccaccgcaagccatgaaaatgaagaccaaaatcaaggcgaagaagaagaa
gaaggagaagaagaagaagaagaagaagaagaaagagcacatgtgcatgaagttgccaaa
agcacaccagcagctacaccagcagctactccaactccatccagcgcttctccaaacaaa
aaagatcttcgttccccaatttgttgtattttgggtcatgtcgataccggtaagactaaa
ttgttagacaaaatcagacaaaccaacgttcaaggtggtgaagctggtggcatcacccaa
cagattggtgccacttatttccccatcgacgctattaaggcaaaaactaaagttatggct
gaatatgaaaaacaaacttttgatgtcccaggtcttttggttattgataccccaggtcac
gaatccttctctaacttacgttcaagaggttcttcattgtgtaacatcgcaattttggtt
attgacattatgcatggtttggaacaacagactattgaatctatcaaactgttaagagat
agaaaggctccatttgtcgttgccctaaacaaaattgatagattatatgactggaaagcc
attccaaacaattcattcagagactcctttgcaaagcaatcaagagctgttcaagaggaa
tttcaatctaggtattctaagattcaattggaattagctgaacaaggtttgaattcggaa
ttgtatttccaaaacaaaaatatgtctaagtatgtctccattgtcccaacatctgccgtc
accggtgagggtgttccagatttattgtggttgctattagaattgacccaaaagaggatg
tccaaacaattgatgtacttgtctcacgtggaagcaaccattttggaagtgaaagtcgta
gaaggttttggtaccacaattgatgttatcttgtccaacggttacttgagagaaggtgac
cgtattgtactgtgtggtatgaatggtccaattgtaacgaatatcagagcattactaaca
ccacaaccattacgtgaactacgtttgaaatctgaatatgtccaccacaaagaagtcaag
gctgctttaggtgtcaagattgccgctaatgatttagaaaaagccgtttctggttctagg
ctgctagttgtcggtcctgaagatgacgaagatgaattgatggacgacgttatggatgat
ttgactggtttgttggactccgttgacacaactggtaaaggtgttgtggtccaagcatcc
accttgggttctttggaagctttgttggatttcttgaaagacatgaaaatccctgtgatg
tctatcgggttaggtccagtgtacaagcgtgatgttatgaaagcctccactatgttggaa
aaggctccagagtatgccgtgatgttatgttttgatgttaaagtggataaggaagctgaa
caatacgctgaacaagaaggaattaagatctttaatgcagacgtcatctatcatttattt
gattcatttacagcataccaagaaaagttattggaagaacgtcgtaaagatttcctagat
tacgctattttcccatgtgtcttacaaaccttacaaattattaacaaacgtggtccaatg
attattggtgtagacgttctggaaggtactctacgtgtgggaactcctatttgcgctgtg
aaaaccgaccctactacaaaggaaagacaaactttgatattaggtaaagtcatctcttta
gaaatcaaccatcaacctgtccaagaagtaaagaagggccaaaccgctgctggtgttgcc
gtccgtctagaagatccctccggtcaacaacctatctggggtcgtcatgttgacgagaat
gatacattatactccttggtttcaagaagatctattgacactttgaaggataaagctttt
agggaccaagttgctagatccgattggctgctattgaagaagctgaaggtcgttttcggc
atcgaatga

Protein sequence

>851196 : length: 1002
MAKKSKKNQQNYWDEEFEEDAAQNEEISATPTPNPESSAGADDTSREASASAEGAEAIEG
DFMSTLKQSKKKQEKKVIEEKKDGKPILKSKKEKEKEKKEKEKQKKKEQAARKKAQQQAQ
KEKNKELNKQNVEKAAAEKAAAEKSQKSKGESDKPSASAKKPAKKVPAGLAALRRQLELK
KQLEEQEKLEREEEERLEKEEEERLANEEKMKEEAKAAKKEKEKAKREKRKAEGKLLTRK
QKEEKKLLERRRAALLSSGNVKVAGLAKKDGEENKPKKVVYSKKKKRTTQENASEAIKSD
SKKDSEVVPDDELKESEDVLIDDWENLALGDDDEEGTNEETQESTASHENEDQNQGEEEE
EGEEEEEEEEERAHVHEVAKSTPAATPAATPTPSSASPNKKDLRSPICCILGHVDTGKTK
LLDKIRQTNVQGGEAGGITQQIGATYFPIDAIKAKTKVMAEYEKQTFDVPGLLVIDTPGH
ESFSNLRSRGSSLCNIAILVIDIMHGLEQQTIESIKLLRDRKAPFVVALNKIDRLYDWKA
IPNNSFRDSFAKQSRAVQEEFQSRYSKIQLELAEQGLNSELYFQNKNMSKYVSIVPTSAV
TGEGVPDLLWLLLELTQKRMSKQLMYLSHVEATILEVKVVEGFGTTIDVILSNGYLREGD
RIVLCGMNGPIVTNIRALLTPQPLRELRLKSEYVHHKEVKAALGVKIAANDLEKAVSGSR
LLVVGPEDDEDELMDDVMDDLTGLLDSVDTTGKGVVVQASTLGSLEALLDFLKDMKIPVM
SIGLGPVYKRDVMKASTMLEKAPEYAVMLCFDVKVDKEAEQYAEQEGIKIFNADVIYHLF
DSFTAYQEKLLEERRKDFLDYAIFPCVLQTLQIINKRGPMIIGVDVLEGTLRVGTPICAV
KTDPTTKERQTLILGKVISLEINHQPVQEVKKGQTAAGVAVRLEDPSGQQPIWGRHVDEN
DTLYSLVSRRSIDTLKDKAFRDQVARSDWLLLKKLKVVFGIE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min