Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851311, GDH2

Organisms

Yeast (4932)

Synonyms

YDL215C;
NAD(+)-dependent glutamate dehydrogenase, degrades glutamate to ammonia and alpha-ketoglutarate; expression sensitive to nitrogen catabolite repression and intracellular ammonia levels

Description

Gdh2p

Xrefs

SGD:S000002374

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851311 PMID: 10688190

Sequence Information

Nucleotide sequence

>851311 : length: 3279
atgctttttgataacaaaaatcgcggtgctttaaactcactgaacacaccagatattgct
tctttatcaatatcatccatgtcggactatcacgtgtttgattttcccggtaaggacctg
cagagagaggaagtgatagatttgctagatcagcaagggtttattcccgacgatttgatc
gaacaagaagtagattggttttataactcattgggtattgacgatttgttcttctcgaga
gaatctccccaattaatctcgaatatcatacattctttgtatgcttcaaagctagatttc
tttgcgaagtccaaattcaacggaattcagccaaggctattcagcattaaaaacaaaatt
ataactaatgataatcatgccatctttatggaatctaatactggtgtcagcataagcgat
tctcagcaaaaaaactttaaatttgctagtgacgccgtcggaaacgatactttggagcat
ggtaaggataccatcaaaaaaaataggattgaaatggatgattcttgtccaccttatgaa
ttagattccgaaattgatgaccttttcctggataacaagtctcaaaaaaactgcagatta
gtttctttttgggctccagaaagcgaattaaagctaacttttgtttatgagagtgtttac
cctaatgatgatccagccggcgtagatatttcctctcaggatttgctgaaaggtgatatt
gaatcgattagtgataagaccatgtacaaagtttcgtcgaacgaaaataaaaaactatac
ggtctcttacttaagttggttaaagaaagagaaggtcctgtcattaagactactcgctcc
gtagaaaataaggatgaaattaggttattagtcgcttacaagcgattcaccactaagcgt
tattactctgctttgaactctttgttccactattacaagttgaaaccttctaagttctat
ttagagtcgtttaatgttaaggatgatgacatcattatcttttccgtttatttgaacgag
aaccagcaattggaagatgttctacttcacgatgtggaggcagcattgaaacaggttgaa
agagaagcttcattgctatacgctatcccaaacaattctttccatgaggtttaccagaga
cgtcaattctcgcccaaagaagctatatatgctcatattggtgctatattcattaaccat
tttgttaatcgtttaggctctgattatcaaaaccttttatctcaaatcaccattaagcgt
aatgatactactcttttggagattgtagaaaacctaaaaagaaagttaagaaatgaaacc
ttaactcagcaaactattatcaacatcatgtcgaagcattacactataatttccaagttg
tataaaaattttgctcaaattcactattatcataatagtactaaagatatggagaagaca
ttatcttttcaaagactggaaaaagtggagccttttaagaatgaccaagagttcgaagct
tacttgaataaattcattccaaatgattcacctgatttgttgatcctgaaaacactgaac
atcttcaacaagtctattttgaagacaaatttctttattacaagaaaagtagcaatatca
ttcagattagatccttccctggtgatgacaaaattcgaatatccagagacaccctatggt
atattttttgtcgttggtaatactttcaaagggttccatatcaggttcagagatatcgca
aggggcggtattcgtatagtctgttccaggaatcaggatatttatgatttgaattccaag
aacgttattgatgagaactatcaattggcctctactcagcaacgtaaaaataaggatatt
ccagagggtggctctaaaggtgtcatcttattgaacccaggattggtagaacatgaccag
acatttgtcgccttttcccaatatgtggatgcaatgattgacattctaatcaacgatcca
ttaaaggaaaactatgtcaaccttttaccaaaggaggaaatattattttttggcccagat
gaaggaactgctggtttcgtggattgggcaactaaccatgctcgtgtgaggaactgccca
tggtggaaatcatttttgactggaaaatccccatctttgggtggtattccccatgacgaa
tatggtatgacttctctgggtgttcgtgcttatgttaataaaatttacgaaactttaaac
ttgacaaattctactgtttacaaattccaaactggtggtccggatggtgatttgggatcc
aatgaaattcttttatcttcgccaaacgaatgttatttggcaattctggacggttcaggt
gtcctgtgtgatcctaaaggtttagataaagatgaattatgccgcttggcacatgaaagg
aaaatgatttccgatttcgacacttccaaattatcaaacaacggattttttgtttctgtg
gatgcaatggatatcatgctaccaaatggtacaattgtagctaacggcacaaccttcaga
aacacctttcatactcaaattttcaaatttgtggatcatgtcgacatttttgttccatgc
ggtggtagaccaaactcaattactctaaataatctacattattttgttgacgaaaagact
gggaaatgtaaaattccatatattgtggagggtgccaatctatttataacgcaacctgct
aaaaatgctttggaggaacatggctgtattctgttcaaagatgcttctgcaaacaaaggt
ggtgtcacatcttcatcaatggaagtgttggcctcactagcgcttaacgataacgacttc
gtgcacaaatttattggagatgttagtggtgagaggtctgcgttgtacaagtcgtacgtt
gtagaagtgcagtcaagaattcagaaaaatgctgaattagagtttggtcagttatggaat
ttgaatcaactaaatggaacccacatttcagaaatttcaaaccaattgtccttcactata
aacaaattgaacgacgatctagttgcttctcaagagttgtggctcaatgatctaaaatta
agaaactacctattgttggataaaataattccaaaaattctgattgatgttgctgggcct
cagtccgtattggaaaacattccagagagctatttgaaagttcttctgtcgagttactta
tcaagcacttttgtttaccagaacggtatcgatgttaacattggaaaattcttggaattt
attggtgggttaaaaagagaagcggaggcaagtgcttga

Protein sequence

>851311 : length: 1092
MLFDNKNRGALNSLNTPDIASLSISSMSDYHVFDFPGKDLQREEVIDLLDQQGFIPDDLI
EQEVDWFYNSLGIDDLFFSRESPQLISNIIHSLYASKLDFFAKSKFNGIQPRLFSIKNKI
ITNDNHAIFMESNTGVSISDSQQKNFKFASDAVGNDTLEHGKDTIKKNRIEMDDSCPPYE
LDSEIDDLFLDNKSQKNCRLVSFWAPESELKLTFVYESVYPNDDPAGVDISSQDLLKGDI
ESISDKTMYKVSSNENKKLYGLLLKLVKEREGPVIKTTRSVENKDEIRLLVAYKRFTTKR
YYSALNSLFHYYKLKPSKFYLESFNVKDDDIIIFSVYLNENQQLEDVLLHDVEAALKQVE
REASLLYAIPNNSFHEVYQRRQFSPKEAIYAHIGAIFINHFVNRLGSDYQNLLSQITIKR
NDTTLLEIVENLKRKLRNETLTQQTIINIMSKHYTIISKLYKNFAQIHYYHNSTKDMEKT
LSFQRLEKVEPFKNDQEFEAYLNKFIPNDSPDLLILKTLNIFNKSILKTNFFITRKVAIS
FRLDPSLVMTKFEYPETPYGIFFVVGNTFKGFHIRFRDIARGGIRIVCSRNQDIYDLNSK
NVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGLVEHDQTFVAFSQYVDAMIDILINDP
LKENYVNLLPKEEILFFGPDEGTAGFVDWATNHARVRNCPWWKSFLTGKSPSLGGIPHDE
YGMTSLGVRAYVNKIYETLNLTNSTVYKFQTGGPDGDLGSNEILLSSPNECYLAILDGSG
VLCDPKGLDKDELCRLAHERKMISDFDTSKLSNNGFFVSVDAMDIMLPNGTIVANGTTFR
NTFHTQIFKFVDHVDIFVPCGGRPNSITLNNLHYFVDEKTGKCKIPYIVEGANLFITQPA
KNALEEHGCILFKDASANKGGVTSSSMEVLASLALNDNDFVHKFIGDVSGERSALYKSYV
VEVQSRIQKNAELEFGQLWNLNQLNGTHISEISNQLSFTINKLNDDLVASQELWLNDLKL
RNYLLLDKIIPKILIDVAGPQSVLENIPESYLKVLLSSYLSSTFVYQNGIDVNIGKFLEF
IGGLKREAEASA



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min