Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851313, NOP6

Organisms

Yeast (4932)

Synonyms

YDL213C;
Putative RNA-binding protein implicated in ribosome biogenesis; contains an RNA recognition motif (RRM) and has similarity to hydrophilins; NOP6 may be a fungal-specific gene as no homologs have been yet identified in higher eukaryotes

Description

Nop6p

Xrefs

SGD:S000002372

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851313 PMID: 11805837

Sequence Information

Nucleotide sequence

>851313 : length: 678
atggggtccgaggaagataaaaagttgaccaagaagcagctcaaagctcagcagtttaga
aaaagtaaggaggaaaaagatcaagagaaagacgtaaaaaaagagcaagcaccagaagga
aaaagacccaacagtgcagccggaaatgatggtgaagaacccgtgaagaaaaaaagaaaa
acacgtagaggccgtggtggtaagggcaaaaatggtaaaaagggcaacagatttattgtc
tttgtcggtagcttacctagagacatcactgctgttgaattgcaaaaccattttaaaaat
agttcacccgaccagatccgcctcagagctgacaaaggtattgcatttttggaattcgat
gctgacaaagatcgcaccggcattcaaagacgtatggacattgccttattacaacatggg
accttactgaaagagaagaagatcaatgtcgagctaactgttggcggaggtggtaacagt
caagagcgtctagaaaaattgaaaaacaaaaacatcaagttggatgaagaacgtaaagag
aggttgacaaagatgattaacgacggcaaccaaaagaaaatcgccaaaactaccgccact
gcagctcaaacctctggaacagacaacaagcctgttcctgcaggaattcatcctgataga
gccaaactacttaaatga

Protein sequence

>851313 : length: 225
MGSEEDKKLTKKQLKAQQFRKSKEEKDQEKDVKKEQAPEGKRPNSAAGNDGEEPVKKKRK
TRRGRGGKGKNGKKGNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFD
ADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGGGGNSQERLEKLKNKNIKLDEERKE
RLTKMINDGNQKKIAKTTATAAQTSGTDNKPVPAGIHPDRAKLLK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min