Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851332, SEC31

Organisms

Yeast (4932)

Synonyms

YDL195W;
WEB1;
Sec31p

Description

Essential phosphoprotein component (p150) of the COPII coat of secretory pathway vesicles, in complex with Sec13p; required for ER-derived transport vesicle formation

Xrefs

SGD:S000002354

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851332 PMID: 16429126

Sequence Information

Nucleotide sequence

>851332 : length: 3822
atggtcaaacttgctgagttttctcgaacagccacgtttgcgtggtcacatgataaaatt
ccattattggtctctggtaccgtatctggtacggtggatgctaatttctccactgattca
tctctagaattgtggtcattgttggctgctgattcggagaagcctattgcttccttgcaa
gtggattccaaattcaatgatttggattggtctcataataacaagattattgctggtgct
ctggataacggtagtttggaattgtactccaccaatgaagcaaacaacgctatcaactcc
atggccagatttagcaaccattcttcctctgtgaagacggtaaagtttaacgcaaagcaa
gacaacgttcttgcttcgggtggtaacaacggtgaaatttttatttgggacatgaataaa
tgcactgaatcgccctccaattatactccattgacaccgggtcaatcgatgtcgtccgtt
gacgaggtcatttccctagcatggaaccaatctttggcccatgtttttgcatctgccggg
tcgtctaatttcgcatctatttgggatttgaaggctaagaaggaagtcattcatctaagt
tacacttcacctaattcaggtatcaagcaacagctgtccgttgttgaatggcacccaaaa
aactccacaagagtggcaacggctactggtagcgataatgatccatctatcctgatctgg
gatttaagaaacgccaacacaccattgcagactttaaatcaaggccatcaaaagggtatt
ttgtcattagattggtgtcatcaggacgaacatctattattgtccagtggtagagataat
accgttcttctatggaaccctgagtcagccgaacaactgtcccaattcccagctcgtgga
aactggtgttttaagaccaaatttgcaccagaggctccagacctatttgcttgtgcctcc
tttgataacaaaattgaggtacagactttgcaaaatctcacaaacactttggatgagcaa
gaaaccgaaactaagcagcaagaatctgaaacagatttttggaataatgtttcccgagag
gaatcaaaagagaagccatctgttttccatttacaagccccaacttggtatggggaacca
tctcccgcagctcattgggctttcggtggtaaattggttcaaattactccagatggtaaa
ggtgtatctataacaaacccaaaaatttcaggcttagaatcaaacactactttgagtgaa
gcgttgaaaactaaggatttcaaaccattaataaatcaaagactggtcaaagttattgat
gacgttaatgaagaagattggaatttattggaaaagttatcaatggacggtactgaggag
ttcttgaaagaggctcttgcattcgacaacgatgaatcagatgcacaagacgatgccaac
aatgagaaagaagacgatggggaagaattctttcaacaaattgaaaccaatttccaaccc
gagggcgatttctccttgtctggtaatatcgaacaaactatttccaagaacttggtttct
ggcaacattaagagcgctgtgaaaaattctctagagaatgacttactaatggaggccatg
gtgatcgcattagattcaaataacgaaagattaaaggaaagtgtcaagaatgcctatttt
gcgaagtatggatctaaatcatcgctctcgaggatactatactccatttctaagagggaa
gtagatgatttggttgaaaatttggatgtctctcagtggaagtttatctctaaagcaatt
caaaacttatatccaaatgatatcgcccagaggaatgaaatgttgattaaattgggagac
aggttaaaggaaaatggtcatagacaagattctttgactttgtacttggctgccggatca
ttagataaggtggcttcaatttggttatcagaatttccagatttggaggataaattgaag
aaagataataagacaatttatgaagctcattccgaatgtctaactgagttcattgaaaga
ttcaccgtattttccaacttcattaatggaagctctaccattaataatgagcaattaatt
gccaaatttttggaatttatcaacttaactacttccacaggaaatttcgaactagccact
gaattcttaaatagtttaccaagtgacaatgaagaggttaaaacagaaaaggcacgtgtc
ttgattgcttccggcaaatcattaccggcacaaaatcctgcgacagcgacgaccagcaaa
gccaagtatacaaacgccaagacaaataagaacgttcctgtactaccaactcctggaatg
ccttctactacttctattcctagtatgcaggcaccattttatggtatgacaccaggcgcc
tctgcaaatgctctacctccaaagccgtacgttccagcaaccaccactagtgctcctgtt
catacagaaggtaaatatgcgccaccaagccaaccttcgatggcgtcaccttttgttaac
aaaacaaatagctcgaccagattgaattcttttgctcctccgcctaacccatatgccact
gcaacagttcctgcaacgaacgtatctacaacgtcgattccgcaaaacacttttgctcct
atacaacctggtatgcctattatgggcgactataatgctcaatctagctctattccttca
caacctccaattaatgctgtatcgggtcaaacgccacatctcaaccgtaaagccaatgat
ggttggaatgatttgcctttgaaggtcaaagaaaaaccatctcgtgccaaggctgtatct
gttgcccctccaaatatcctatcgacaccaactccattaaatggtatccctgcaaatgct
gctagtaccatgcctccgccacctctttccagagctccctcttctgtgtcaatggtatca
ccacctcctctacacaaaaattctagagtcccatccttggttgcaacttctgagtcacca
agggcatccatatcaaatccatacgctcctcctcaatcatcacaacaattcccaataggt
actatttctacagcaaaccaaacgtcaaacaccgctcaggtagcttcatcgaacccctat
gctccaccaccacaacaaagagtagcaaccccattatctggaggcgtgcctccagctccg
ttgccaaaggcctctaatccatatgctccaactgcaaccactcaacccaacggttcctcc
tatcctccaaccggtccgtatactaataaccataccatgacctctcctcctcccgttttt
aacaaacctcccactggcccccctccgattagcatgaagaagagaagcaacaagttagct
agtatagaacaaaacccatctcaaggtgctacttatcctccaaccctttccagctcggcc
tctccattgcagccttctcaaccgccaactttggcttctcaggttaatacctccgctgag
aatgtcagtcatgaaattccagctgatcaacaacccattgtcgacttcttgaaagaagaa
ctggctcgcgtaacaccattgaccccaaaggagtactccaaacaattaaaggattgtgat
aaacgattaaagattcttttctaccatttggaaaagcaggatttattaacccaaccaaca
atcgattgtttacatgacctcgtcgcattaatgaaggaaaagaaatacaaagaagctatg
gtcatccatgctaatatcgctacaaaccatgctcaagagggtggtaactggctgacagga
gtgaagaggttgattggcatagctgaagcgactttgaattaa

Protein sequence

>851332 : length: 1273
MVKLAEFSRTATFAWSHDKIPLLVSGTVSGTVDANFSTDSSLELWSLLAADSEKPIASLQ
VDSKFNDLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQ
DNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAG
SSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIW
DLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPARG
NWCFKTKFAPEAPDLFACASFDNKIEVQTLQNLTNTLDEQETETKQQESETDFWNNVSRE
ESKEKPSVFHLQAPTWYGEPSPAAHWAFGGKLVQITPDGKGVSITNPKISGLESNTTLSE
ALKTKDFKPLINQRLVKVIDDVNEEDWNLLEKLSMDGTEEFLKEALAFDNDESDAQDDAN
NEKEDDGEEFFQQIETNFQPEGDFSLSGNIEQTISKNLVSGNIKSAVKNSLENDLLMEAM
VIALDSNNERLKESVKNAYFAKYGSKSSLSRILYSISKREVDDLVENLDVSQWKFISKAI
QNLYPNDIAQRNEMLIKLGDRLKENGHRQDSLTLYLAAGSLDKVASIWLSEFPDLEDKLK
KDNKTIYEAHSECLTEFIERFTVFSNFINGSSTINNEQLIAKFLEFINLTTSTGNFELAT
EFLNSLPSDNEEVKTEKARVLIASGKSLPAQNPATATTSKAKYTNAKTNKNVPVLPTPGM
PSTTSIPSMQAPFYGMTPGASANALPPKPYVPATTTSAPVHTEGKYAPPSQPSMASPFVN
KTNSSTRLNSFAPPPNPYATATVPATNVSTTSIPQNTFAPIQPGMPIMGDYNAQSSSIPS
QPPINAVSGQTPHLNRKANDGWNDLPLKVKEKPSRAKAVSVAPPNILSTPTPLNGIPANA
ASTMPPPPLSRAPSSVSMVSPPPLHKNSRVPSLVATSESPRASISNPYAPPQSSQQFPIG
TISTANQTSNTAQVASSNPYAPPPQQRVATPLSGGVPPAPLPKASNPYAPTATTQPNGSS
YPPTGPYTNNHTMTSPPPVFNKPPTGPPPISMKKRSNKLASIEQNPSQGATYPPTLSSSA
SPLQPSQPPTLASQVNTSAENVSHEIPADQQPIVDFLKEELARVTPLTPKEYSKQLKDCD
KRLKILFYHLEKQDLLTQPTIDCLHDLVALMKEKKYKEAMVIHANIATNHAQEGGNWLTG
VKRLIGIAEATLN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min