Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851415, RPO21

Organisms

Yeast (4932)

Synonyms

YDL140C;
RPB1|RPB220|SUA8;
Rpo21p

Description

RNA polymerase II largest subunit B220, part of central core; phosphorylation of C-terminal heptapeptide repeat domain regulates association with transcription and splicing factors; similar to bacterial beta-prime

Xrefs

SGD:S000002299

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

853288 851415 PMID: 15861138
856626 851415 PMID: 11441018

Sequence Information

Nucleotide sequence

>851415 : length: 5202
atggtaggacaacagtattctagtgctccactccgtacagtaaaagaggtccaattcggt
cttttctcacctgaagaagttagagcaatcagtgtggccaaaattagatttccagagaca
atggatgaaacccagacgagagcgaaaattggtggtctaaacgaccctaggttaggctct
attgatcgtaatctgaagtgtcaaacttgtcaagagggtatgaacgaatgtcctggtcat
tttggtcacatagatttagcaaaacctgtatttcatgttggttttattgccaaaattaag
aaagtatgtgagtgtgtctgtatgcactgtggtaagctattactggatgaacataatgaa
ttaatgagacaagctctagcaatcaaagacagtaaaaaaaggtttgctgcaatttggact
ttatgtaaaacaaaaatggtctgcgaaacagatgtcccttctgaagatgatcctactcag
ctcgtatcaaggggaggttgtggtaatacacagcctacaattcgtaaggatgggttgaaa
ttagttggtagttggaaaaaagatagagccacgggggatgcggatgaaccagaactaaga
gttttaagtacggaggaaatcttgaatatttttaagcatatctcagtaaaagacttcact
agtttgggtttcaacgaagttttttctcgtccagaatggatgattttaacatgccttcct
gtcccaccaccaccggtgcgtccatccatttccttcaatgaatctcaaagaggtgaggat
gatttaacctttaaacttgctgatattttaaaagctaatattagtttggaaacactagag
cataacggtgctccacatcatgctattgaagaagcagagagtttattacaatttcatgtt
gccacttatatggataatgatattgctggtcaaccacaagctcttcaaaagtccggccgt
cccgttaaatctattcgtgctcgtttgaagggtaaagagggtcgtatcagaggtaattta
atgggtaagcgtgtggatttttcggcaagaactgttatttctggtgatcctaatttggaa
ttagaccaagtcggtgttccaaaatctattgccaagactttaacatacccagaagtggtc
acaccatataacatagatcgtctgacgcaacttgttaggaatggaccaaatgagcacccc
ggtgccaaatacgtcattcgtgatagcggagaccgtatagatttaagatacagtaaaagg
gcaggtgatattcaattacagtatgggtggaaagttgaacgtcatattatggacaatgat
ccagttttattcaaccgtcaaccttcgttgcacaaaatgtccatgatggcccacagagta
aaagttattccatattctacatttagattgaatttgtccgttacatctccatacaatgcc
gatttcgacggtgacgaaatgaatcttcacgttcctcagtctgaggaaacaagggcggaa
ctttctcaattatgtgctgttcctctgcaaattgtttcaccacaatctaacaaaccttgt
atgggtattgttcaagatactttgtgtggtattcgtaaactgacattaagagatacattt
atagaacttgatcaagttttgaatatgctttattgggttccagattgggatggtgttatt
ccgacacctgcaattatcaagcccaaacctttgtggtccggtaaacaaatcttgtctgtg
gctatcccaaacggtattcatttacaacgttttgatgagggcactactctgctttctcca
aaggataatggtatgcttattattgacggtcaaatcatttttggtgtagtagagaaaaaa
accgttggttcctccaatggtggtttaattcatgttgttacgagagaaaagggacctcaa
gtttgtgctaagttgtttggtaacatacagaaagttgttaacttttggttactacataat
gggttttcaacaggtattggtgataccattgcggacggcccaacaatgagggaaattaca
gagacaattgcagaggctaaaaagaaagttttggatgttacgaaagaagcccaggcaaac
ttattgactgctaaacatggtatgactctccgtgagtcttttgaggataacgttgttcgg
ttcctaaatgaagcaagagataaggcaggtcgtttagctgaagtcaatttgaaagatttg
aacaatgtgaaacaaatggttatggcaggttccaagggttcatttattaatatcgcgcaa
atgtcagcttgtgtaggacagcaatctgttgaaggtaaacgtattgcttttgggttcgtt
gatcgtaccttacctcatttctctaaagatgattactccccagagtctaaaggttttgtt
gagaactcatatttgagaggtttgaccccacaagaattttttttccatgcaatgggtggt
cgtgaaggtcttatcgataccgccgtcaaaacagccgaaacaggttatattcaacgtcgt
ttagtgaaagctctagaagatatcatggttcattacgataacaccacaagaaactcattg
ggtaacgttattcagtttatttatggtgaagatggtatggatgctgcgcatattgaaaag
caatcgctagatactattggtggctccgatgcagcttttgaaaagagatacagagttgat
ttattgaatacagaccatacccttgatccctcactattggaatccggatctgagatactt
ggcgatttgaaacttcaagttctcctggatgaagaatacaaacaattagtgaaagatcgt
aaatttttgagggaagtttttgttgatggtgaagcaaactggccattaccagtcaacata
agacgtattattcaaaatgctcaacaaactttccacatagatcatacgaaaccatctgat
ttaacaatcaaagacatcgttcttggtgtaaaggatttgcaagaaaacttattagtgttg
cgtggtaagaatgaaattatacaaaatgcccagcgagatgcagttacattgttctgctgt
ttattacgttcccgtttggccacacgtagagttctacaagagtacagactaacaaaacag
gcattcgattgggtattaagtaatatcgaggcacaattcctccgttctgttgttcaccct
ggtgaaatggttggtgttctagcagcccaatccattggtgaaccagccacacaaatgacc
cttaacaccttccattttgctggtgttgcttccaaaaaagttacttctggtgtcccccgt
ttaaaggaaattttgaatgtggccaaaaacatgaaaaccccttccttgactgtatactta
gagcctggtcatgctgccgatcaagaacaagcgaagttgatcagatctgctatcgagcat
accactttaaagagtgtcactattgcttcagaaatttactatgatcctgatccacgttcc
acagttattccagaagatgaagaaattatccaacttcatttctcattattggatgaagag
gctgaacaatcttttgaccaacaatcaccttggttattacgtctggaactggatcgtgca
gcaatgaatgataaagacttaacaatgggtcaggttggtgaaagaatcaagcaaacattc
aaaaatgatttgtttgttatctggtctgaagacaacgatgagaagttgatcatccgttgt
cgtgttgttcgtccaaagtcactagatgctgagactgaagcagaagaagatcatatgttg
aagaaaattgagaacacaatgttagagaatattacattacgtggtgtagagaacatcgag
cgtgttgtcatgatgaaatatgaccgtaaagtaccaagtccaactggtgaatacgttaag
gaacctgaatgggtgttggaaacagatggtgttaacttatctgaagttatgactgttcct
ggtatcgacccaaccagaatctataccaactccttcattgatataatggaagttctaggt
attgaagctggtcgtgcagccttgtataaagaagtttacaatgttattgcttctgatggt
tcgtatgttaactaccgtcatatggctttgttagtcgatgttatgacaacccaaggtggc
ttaacttctgttactcgtcatggtttcaacagatcaaatacaggtgccttaatgagatgt
tcatttgaagaaactgtcgaaattttgtttgaagctggtgcttcagccgaattagatgat
tgtcgtggtgtttcggaaaatgtcattcttggtcaaatggctccaatcggtaccggtgca
tttgatgtgatgatcgatgaggagtcactggtaaaatacatgccagaacaaaaaataact
gagattgaagacggacaagatggtggcgtcacaccatacagtaacgaaagtggtttggtc
aatgcagatcttgacgttaaagatgagctaatgttttcacctctggttgattcgggttca
aatgacgctatggctggaggatttacagcgtacggtggtgctgattatggtgaagccacg
tctccatttggtgcttatggtgaagcacctacatctcccggatttggagtctcctcacca
ggcttttctccaacttccccaacatactctcctacctctccagcgtactcaccaacatca
ccatcgtactcaccaacatcaccatcgtactcgccaacatcaccatcgtactcacctaca
tcaccatcgtattcaccaacgtcaccatcatattcgccaacgtcaccatcatattcgcca
acgtcgccatcgtattctccaacgtcaccatcgtattcgccaacgtcgccttcctactct
cccacgtcgccaagctacagccctacgtctccttcttattctcctacatctccatcatac
tctcctacgtcaccaagttacagcccaacgtcaccaagttacagcccaacgtctccagcc
tattccccaacatcaccaagttatagtcctacatcgccttcatactctccaacatcacca
tcctattccccaacatcaccttcttactctcccacctctccaaactatagccctacttca
ccttcttactccccaacatctccaggctacagcccaggatctcctgcatattctccaaag
caagacgaacaaaagcataatgaaaatgaaaattccagatga

Protein sequence

>851415 : length: 1733
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min