Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851477, RPL13A

Organisms

Yeast (4932)

Synonyms

YDL082W;
Rpl13ap

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Bp; not essential for viability; has similarity to rat L13 ribosomal protein

Xrefs

SGD:S000002240

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851477 PMID: 17200106

Sequence Information

Nucleotide sequence

>851477 : length: 600
atggccatttccaagaatttaccaatcttaaagaatcatttcagaaagcactggcaagaa
cgtgttaaagtgcacttcgaccaagctggtaagaaggtttctagacgtaatgctagagct
accagagccgctaagattgctccaagacctctagatctcttgagacctgttgttagagcc
ccaactgttaagtataacagaaaggtcagagctggcagaggtttcaccttggctgaagtt
aaggccgctggtttgactgctgcttatgccagaactatcggtatcgccgttgaccacaga
cgtcaaaacagaaaccaagaaatctttgatgctaacgttcaaagattaaaggaataccaa
tctaagattattgttttcccaagaaatggtaaggccccagaagctgaacaagttttgtct
gctgctgctactttcccaattgctcaaccagctaccgatgttgaagctagagctgtccaa
gacaatggtgaatctgctttcagaaccttgagattagccagatctgagaagaaattcaga
ggtatcagagaaaagagagctagagaaaaggctgaagctgaagctgaaaagaagaaatag

Protein sequence

>851477 : length: 199
MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRA
PTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQ
SKIIVFPRNGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNGESAFRTLRLARSEKKFR
GIREKRAREKAEAEAEKKK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min