Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851636, RPS13

Organisms

Yeast (4932)

Synonyms

YDR064W;
RPS13B|RPS13C;
Rps13p

Description

Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S15 and rat S13 ribosomal proteins

Xrefs

SGD:S000002471

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851636 PMID: 17200106

Sequence Information

Nucleotide sequence

>851636 : length: 456
atgggtcgtatgcacagtgccggtaaaggtatttcttcttctgctattccatactctaga
aatgctccagcttggttcaagttgtcctctgaatctgtcattgaacaaattgtcaagtac
gcgagaaagggtttgactccatctcaaattggtgtcttgttgagagatgctcacggtgtt
acccaagctcgtgttatcactggtaacaagatcatgagaatcttgaagtccaatggtttg
gctccagaaatcccagaagatttgtactacttgattaagaaggctgtctctgttagaaag
cacttggaaagaaacagaaaggacaaagacgctaagttcagattgattttgatcgaatct
agaattcacagattggccagatactacagaactgttgctgtcttaccaccaaactggaag
tacgaatccgccactgcctccgctttggtcaactag

Protein sequence

>851636 : length: 151
MGRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIGVLLRDAHGV
TQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKDKDAKFRLILIES
RIHRLARYYRTVAVLPPNWKYESATASALVN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min