Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851665, RLI1

Organisms

Yeast (4932)

Synonyms

YDR091C;
Rli1p

Description

Essential iron-sulfur protein required for ribosome biogenesis and translation initiation; facilitates binding of a multifactor complex (MFC) of translation initiation factors to the small ribosomal subunit; predicted ABC family ATPase

Xrefs

SGD:S000002498

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851665 PMID: 16429126

Sequence Information

Nucleotide sequence

>851665 : length: 1827
atgagtgataaaaacagtcgtatcgctatcgttagcgctgataaatgtaaaccaaaaaag
tgtcgtcaagagtgtaaacgttcgtgtcccgttgtgaaaactggtaaattatgtattgaa
gtcactccaacttcaaaaatcgcattcatttccgaaatcttgtgtattggttgtggtatt
tgcgttaagaaatgtccatttgatgctattcaaattatcaatttgccaactaatttagaa
gcccatgtaactcaccgttactctgccaatagtttcaaactgcacagattgccaacacca
agaccgggtcaagtccttggtttagtcggtaccaacggtattggtaagtctaccgccttg
aaaatcttagccggtaaacaaaaacctaatttaggtcgttttgatgatcctcctgaatgg
caggaaattattaaatatttccgtggttctgaattacaaaattacttcaccaagatgctg
gaagatgatatcaaggctataatcaaacctcaatatgttgataacattcctcgtgctatt
aaaggtccggttcaaaaagttggcgaacttttgaaattgagaatggaaaaaagtcctgaa
gatgtgaaacgctacatcaaaattttacagttggaaaacgttttgaaaagagatattgaa
aagttatctggtggtgaactgcaaagatttgccattggtatgtcatgtgttcaagaggct
gatgtttatatgttcgatgaaccttcatcttatttggatgttaagcaacgtttgaatgcc
gctcaaattattagatctttactagctccaactaaatacgttatttgtgttgagcacgat
ttgtcagttttggattatctttccgatttcgtttgtatcatatatggtgttccatctgtt
tacggtgttgttacattaccagcctctgtcagagaaggtatcaacatattcttggacggt
catattcctgctgaaaacctgagattcagaactgaagctttacaatttagaatagctgat
gctaccgaagacttgcagaatgactctgctagtcgcgccttctcttacccaagtttgaag
aaaactcaaggtgattttgttttgaatgttgaagaaggtgaattctccgattccgaaatc
cttgttatgatgggtgaaaacggtaccggtaagaccactttgatcaaattactagctggt
gctttgaagccagatgaaggacaagatattccaaaattgaatgtttctatgaaaccacaa
aaaattgcaccaaagttcccaggtactgtcagacaattgtttttcaagaaaattagagga
caattcctaaatccacagtttcagactgatgtcgttaaacctttaaggattgacgatatt
attgatcaagaagtccaacatttgtctggtggtgaattacaaagagtcgccatcgtcttg
gcattgggtatcccagcagacatatacttgattgatgagccatctgcctacttagattcc
gaacaacgtattatctgttctaaagttatcagaagattcatcttacataataagaaaact
gcgtttattgtcgagcacgatttcatcatggctacttatcttgctgataaggtcattgtt
tttgaaggtattccttccaagaatgctcacgcaagagcccctgaatctttgttgactggt
tgtaacagatttttgaagaatttgaatgtcaccttcagaagggatccaaactccttcaga
ccaagaattaataagctagattcccaaatggataaagaacaaaaatcatcaggaaactac
tttttcttggataacaccggtatttaa

Protein sequence

>851665 : length: 608
MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA
DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV
YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK
KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ
KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL
ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNY
FFLDNTGI



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min