Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851699, DPB4

Organisms

Yeast (4932)

Synonyms

YDR121W;
Shared subunit of DNA polymerase (II) epsilon and of ISW2/yCHRAC chromatin accessibility complex; involved in both chromosomal DNA replication and in inheritance of telomeric silencing

Description

Dpb4p

Xrefs

SGD:S000002528

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851699 PMID: 16429126

Sequence Information

Nucleotide sequence

>851699 : length: 591
atgccaccaaaaggttggagaaaagacgcccaagggaattaccccactacttcgtatatt
aaagaacaagagaacattacgattcaggacctgttatttcctaaaagcactattgtgaat
ttggcacgcgaagtgccacagcaaagcggcaaaaagctgctgataaataaagacgcatca
ctagcgttacagcgtggtgctacagtatttgttaaccacttgctcctgtttgcaagggaa
attgcaaagagtcaagataaaaaaagctgcagtgtagatgatgttctgagtgctttggac
catataggacactcggcattgaagggtccggttagagataaactagatgaataccaagct
gctgttgaacagaggaagaaggaaaaactagatagtggtgaagtagatgctgatggcgat
atagatatgggtgaagataaggagaatgtgcccgtggaaaaggttaaagagcatgacgaa
atagaagaacaaggcgatgcattacaggacgtagaagagtcctccgaaaagaaacagaaa
acggagagccaagatgtagaaactagagttcaaaaccttgagcaaacgtaa

Protein sequence

>851699 : length: 196
MPPKGWRKDAQGNYPTTSYIKEQENITIQDLLFPKSTIVNLAREVPQQSGKKLLINKDAS
LALQRGATVFVNHLLLFAREIAKSQDKKSCSVDDVLSALDHIGHSALKGPVRDKLDEYQA
AVEQRKKEKLDSGEVDADGDIDMGEDKENVPVEKVKEHDEIEEQGDALQDVEESSEKKQK
TESQDVETRVQNLEQT



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min