Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851745, TAF10

Organisms

Yeast (4932)

Synonyms

YDR167W;
TAF23|TAF25;
Taf10p

Description

Subunit (145 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification

Xrefs

SGD:S000002574

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851745 PMID: 10688190

Sequence Information

Nucleotide sequence

>851745 : length: 621
atggattttgaggaagattacgatgcggagtttgatgataatcaagaaggacaattagaa
acaccttttccatcggttgcgggagccgatgatggggacaatgataatgatgactctgtc
gcagaaaacatgaagaagaagcaaaagagagaggctgtagtggatgatgggagtgaaaat
gcatttggtatacccgaatttacaagaaaagataagactctggaggagattctagagatg
atggacagtactcctcctatcattcccgatgcagtaatagactactatttaaccaaaaac
gggtttaacgtagcagatgtacgagtgaaacgacttttagcacttgctactcagaaattt
gttagtgatatagctaaggatgcctacgaatattccaggatcaggtcttccgtagcggta
tctaatgctaacaacagtcaggcgagagctaggcagctattgcaaggacagcaacagcct
ggcgtgcagcagatttcacaacaacaacatcaacagaatgagaagactacagcaagcaaa
gttgttctgacggtgaacgatctcagtagcgctgttgctgaatacgggctcaatataggt
cgcccagacttttatcgttag

Protein sequence

>851745 : length: 206
MDFEEDYDAEFDDNQEGQLETPFPSVAGADDGDNDNDDSVAENMKKKQKREAVVDDGSEN
AFGIPEFTRKDKTLEEILEMMDSTPPIIPDAVIDYYLTKNGFNVADVRVKRLLALATQKF
VSDIAKDAYEYSRIRSSVAVSNANNSQARARQLLQGQQQPGVQQISQQQHQQNEKTTASK
VVLTVNDLSSAVAEYGLNIGRPDFYR



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min