Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851814, PCF11

Organisms

Yeast (4932)

Synonyms

YDR228C;
mRNA 3' end processing factor, essential component of cleavage and polyadenylation factor IA (CF IA), involved in pre-mRNA 3' end processing and in transcription termination; binds C-terminal domain of largest subunit of RNA pol II (Rpo21p)

Description

Pcf11p

Xrefs

SGD:S000002636

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851814 PMID: 16429126
856626 851814 PMID: 17200106
851152 851814 PMID: 16429126

Sequence Information

Nucleotide sequence

>851814 : length: 1881
atggatcacgacacagaagttatagtcaaggatttcaacagtattcttgaagaattaact
tttaactcgagacccattattaccactctcacgaagttagcagaagaaaacatttcgtgt
gctcaatattttgttgacgccattgagagtagaattgaaaaatgtatgcctaagcagaag
ctatacgctttttatgccttggactccatttgtaagaatgttggcagcccatacacaatc
tacttcagtagaaatttgtttaacttgtacaaaagaacatacttattggtggacaacacc
acaagaacaaaactcatcaatatgtttaagctttggttgaatcctaatgacaccggcctg
cctctgtttgaaggctcagcactggagaaaattgaacagtttttaataaaggccagtgct
ctccaccagaaaaacctgcaagcaatgttaccaactccgactgttcccctcctattaaga
gacattgataaattaacttgtttaactagtgaaaggctaaagaatcaaccaaatgatgaa
aaattaaaaatgaaactgttggttttatctcagttgaaacaagaactgaaaagagaaaaa
ctaactctcaatgctctgaaacaagttcaaatgcaactaaggcaggtcttctcacaggac
caacaagttttgcaggaaagaatgaggtatcacgaacttcagcagcaacagcaacaacag
cagcaacagcaacaacaacaacagcagcagcagcagcagtatcacgaaactaaggatatg
gtcggttcttacacacaaaactctaattcagcgattccattgtttggaaataattcagat
acaacgaaccaacagaattctttatcttcctctctttttggtaatatttctggcgttgaa
tcttttcaagaaattgagaaaaaaaagtccctaaacaaaatcaataacctctatgcatct
cttaaggctgaagggctcatatatactccaccaaaagaatccatcgtaacgctttataaa
aagctaaatggacactcaaactactctcttgattcacacgaaaaacaattgatgaagaac
ctgccaaagatacccttattaaatgatattctttctgactgcaaagcttattttgccacg
gttaacatcgacgttttgaataacccatccctgcagctgtccgaacaaactcttcttcaa
gaaaatcccatcgtccaaaataatcttattcacttattataccgatccaagccaaataaa
tgtagcgtgtgtggtaagagatttggcaactcagaaagtgaaaaactactacaaaatgag
catttggactggcatttcagaataaatacaagaattaagggatcacaaaacacagcaaat
acaggcataagcaactctaacttaaatacaactaccacaaggaaaaatattcaatcaaga
aactggtatttgagtgactctcaatgggcagccttcaaagatgatgaaattacctccaca
aagcataaaaatgattatactgatccgcatgccaataaaaatatcgataaaagtgcccta
aatattcacgctgatgaaaatgacgaaggctctgtagacaacactttaggaagtgataga
agtaacgagttggaaatacggggaaaatatgttgttgtaccagaaacttcacaagatatg
gccttcaaatgtccaatttgtaaggaaaccgttactggcgtttatgatgaagaatctggt
gaatgggtttggaaaaatactattgaagtgaatggcaaatatttccactcgacatgttat
catgaaacgtcgcaaaattcaagcaaatctaatagtggcaaggtcggtttggatgactta
aagaaattggtcacaaaataa

Protein sequence

>851814 : length: 626
MDHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQK
LYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGL
PLFEGSALEKIEQFLIKASALHQKNLQAMLPTPTVPLLLRDIDKLTCLTSERLKNQPNDE
KLKMKLLVLSQLKQELKREKLTLNALKQVQMQLRQVFSQDQQVLQERMRYHELQQQQQQQ
QQQQQQQQQQQQQYHETKDMVGSYTQNSNSAIPLFGNNSDTTNQQNSLSSSLFGNISGVE
SFQEIEKKKSLNKINNLYASLKAEGLIYTPPKESIVTLYKKLNGHSNYSLDSHEKQLMKN
LPKIPLLNDILSDCKAYFATVNIDVLNNPSLQLSEQTLLQENPIVQNNLIHLLYRSKPNK
CSVCGKRFGNSESEKLLQNEHLDWHFRINTRIKGSQNTANTGISNSNLNTTTTRKNIQSR
NWYLSDSQWAAFKDDEITSTKHKNDYTDPHANKNIDKSALNIHADENDEGSVDNTLGSDR
SNELEIRGKYVVVPETSQDMAFKCPICKETVTGVYDEESGEWVWKNTIEVNGKYFHSTCY
HETSQNSSKSNSGKVGLDDLKKLVTK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min