Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851874, RRP45

Organisms

Yeast (4932)

Synonyms

YDR280W;
Rrp45p

Description

Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex

Xrefs

SGD:S000002688

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851874 PMID: 16554755

Sequence Information

Nucleotide sequence

>851874 : length: 918
atggccaaagacattgagatatccgcatccgagtcaaaatttatcttagaagcactgaga
cagaattataggttggacggccgctcctttgatcaatttcgtgacgtggaaataacgttt
ggtaaagaatttggtgatgttagcgtaaaaatgggcaacaccaaagttcactgcaggatt
agttgtcaaatagcacaaccatacgaagacaggccatttgaaggattatttgtaatatct
acagaaatatctcctatggctggttctcaatttgaaaatggaaatatcacgggggaagat
gaagttttatgttcaagaataattgaaaaatctgttaggcggtcgggcgcattggacgtg
gaaggactatgtatcgttgctggcagtaaatgctgggctgtgagagctgatgtacatttc
ctggattgtgatggtggatttattgacgcttcgtgtattgccgtcatggcaggattgatg
cattttaagaaaccagatataactgtccatggcgagcagatcattgttcatcctgttaat
gaaagagagccagttccactaggtatactgcatattccaatatgtgtaactttttctttc
ttcaatcctcaagacaccgaggaaaacataaaaggtgagactaactcagaaatttccatc
attgatgcaacattgaaagaggaactactgcgagatggtgtattgacggttacgctaaac
aaaaaccgtgaagtggtacaagtttccaaagcgggtggtttaccaatggatgcgttgacg
ctaatgaaatgttgtcacgaggcttacagcattattgagaaaataactgatcaaatactg
cagcttttaaaggaggattcagaaaagagaaacaagtatgcagccatgcttacatctgaa
aatgcccgcgagatctaa

Protein sequence

>851874 : length: 305
MAKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRI
SCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDV
EGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVN
EREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLN
KNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSE
NAREI



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min