Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851906, TFB1

Organisms

Yeast (4932)

Synonyms

YDR311W;
Tfb1p

Description

Subunit of TFIIH and nucleotide excision repair factor 3 complexes, required for nucleotide excision repair, target for transcriptional activators

Xrefs

SGD:S000002719

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851906 PMID: 16429126

Sequence Information

Nucleotide sequence

>851906 : length: 1929
atgtcacattccggagctgccatttttgagaaagtttctgggataattgccataaatgag
gatgtttcacccgcagaattgacatggaggtctacggacggtgacaaggttcacacagtt
gtcttatccactattgacaagttacaagctacccctgcttccagtgaaaaaatgatgttg
aggctaatcgggaaagtggatgagtcaaaaaagagaaaagacaacgaaggaaatgaggtt
gtgcccaaaccgcaacgtcatatgttttcgtttaacaatagaacagttatggataatatc
aagatgacccttcaacaaatcatctcacggtataaagatgcagatatctacgaagaaaag
agaagaagagaggagtctgcgcaacacacagaaacaccaatgagctcttcttctgttact
gcagggactcccacaccacatctcgatacaccacaattgaataatggggctccgttgatt
aatacagccaaactagatgattctctctctaaagaaaaattgttgaccaatttaaagcta
cagcaatctttactgaaaggaaacaaagttctaatgaaggtttttcaggaaacagtcatt
aacgccggtttgcctccatctgaattttggtcaactagaattccgttattgagggctttt
gccttatctacttctcaaaaagttgggccttacaacgttttgtcaactatcaagccggtg
gcttcatcggaaaacaaagtcaatgttaatttgtcaagagaaaaaattttgaatattttt
gagaactatccaattgtaaagaaagcttacactgataatgtgcccaaaaatttcaaagaa
ccagagttctgggcaaggttcttctcttcgaagttattcagaaaattaaggggtgaaaag
atcatgcaaaatgatagaggtgacgtaatcattgacaggtacttgacattggatcaagag
ttcgacagaaaagatgatgacatgctattgcatcctgtgaaaaaaattatagatttagat
ggtaacatacaggacgacccagttgtacgaggcaacaggcccgacttcactatgcagcca
ggtgtggatattaatggtaatagcgatggtaccgtggacatcttaaagggtatgaataga
ttgagtgaaaaaatgattatggctttgaagaatgagtattcaaggacaaatctacagaac
aaatctaatattacaaacgatgaggaagatgaagataatgatgaaagaaatgaactgaaa
atcgatgacttaaacgaaagctacaagacaaactatgcaatcatacatctgaaaaggaac
gcacatgaaaagacaaccgacaacgatgcgaaaagctcggcagactcgataaagaatgca
gatttgaaggtttctaatcaacaaatgttacaacagttgtcattggtcatggataattta
attaataagctagacttgaaccaagtagttcctaacaacgaagtcagcaacaagatcaat
aaaagagtcataactgcaatcaagattaacgccaaacaggctaagcataacaatgttaat
tcagcactcggctcttttgtcgacaacacttctcaagcaaatgaattagaggtgaaaagt
accctaccaatagacctattagaaagttgtagaatgctacacacaacgtgctgtgaattt
ctaaagcacttttatattcattttcagagcggtgaacaaaagcaagccagtaccgtcaaa
aaactttataatcatttgaaggactgtattgaaaagctgaatgagctatttcaagacgtc
cttaatggtgatggtgaatctatgtcaaacacatgtaccgcctatttgaagccagttttg
aactccattactttggctactcataagtacgatgagtacttcaacgaatataacaacaat
tcgaactag

Protein sequence

>851906 : length: 642
MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMML
RLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEK
RRREESAQHTETPMSSSSVTAGTPTPHLDTPQLNNGAPLINTAKLDDSLSKEKLLTNLKL
QQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNVLSTIKPV
ASSENKVNVNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLRGEK
IMQNDRGDVIIDRYLTLDQEFDRKDDDMLLHPVKKIIDLDGNIQDDPVVRGNRPDFTMQP
GVDINGNSDGTVDILKGMNRLSEKMIMALKNEYSRTNLQNKSNITNDEEDEDNDERNELK
IDDLNESYKTNYAIIHLKRNAHEKTTDNDAKSSADSIKNADLKVSNQQMLQQLSLVMDNL
INKLDLNQVVPNNEVSNKINKRVITAIKINAKQAKHNNVNSALGSFVDNTSQANELEVKS
TLPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDV
LNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min