Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851969, ESF1

Organisms

Yeast (4932)

Synonyms

YDR365C;
Nucleolar protein involved in pre-rRNA processing; depletion causes severely decreased 18S rRNA levels

Description

Esf1p

Xrefs

SGD:S000002773

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 851969 PMID: 11805837

Sequence Information

Nucleotide sequence

>851969 : length: 1887
atggctggagagaacccaaagaaggaaggtgtagatgctaggtttgccgggatctacagc
gatcctaaatttaagaacacgaaaaccaaagatcataagatcaagttagattctaggttc
agtaagaaggatctggaggtccagcataaatctaaggttgacaagtatggtagaaagatc
aaaaatgcgcagaataacagggaattggaagatttcgacaaatatttcgaaaaggaagca
gaaaatgatgaagattcagaagttaatgcgaaaacagtagtggaccgtgcccgtggtgaa
gttcctgatgattatgttagctcttctgatgaattcacttcttctgattctgaatcgtcc
ggagaaagtgaagttgaaagcgaagaagaaaatgaagtagaaattgaaaatgccaaacca
gaatctggtgacatctctaagaatttggccgtcgtaaatttagattgggaccatgttaaa
tctgaggatttgatgattaccttttccagtttcgttcctaaaggtggtaaaattgaaaga
gttgctatttatccaagtgaatttggtaaagaaagaatgcaacgcgaggaagttgaagga
cctccaaaggaacttttccaaaagaaaaataagaacaaaacctccaaaaagaagaaaact
gatgactctgattctgatatggacatcggtattaaggatctttatgaagagggagatgct
gacaaggacgtggattccagagctttacgtcaataccagttggacagattaagatattat
tacgcaatagtttattgtagtgatacaaccacctccaaagctatctatgataactgtgat
ggtaccgaatatgagtcaaccgctaatatgttcgatttaaggtatgttcctgatggtatg
acttttgatgatgatgtaagagatgaatgcagtatattgcctaagaactataggccacac
cagtttagcacagatgctctacaacattcaagcgtcaaattgacctgggatgaaacgcca
gctgatagggtcgaagttgctaagagggcctttacccaaaaggaaattgatgatatggac
tttaaggcttacttggcgtcagatagtgatgaatcggatgggcaggtcgatgaagaggcg
aaaaataaactaaagtcgttggttggtgactttgggtttaattccaagaaagaaacccct
aacgatgaagatgaagaagttgatatggaaattacatttactccagccttggaaggagga
aacgagaaatcgtcggaagacaaagaagaaacgactatagagaaaataagaagaaaagag
aaggaacgtcgtaaagcaagaaagcagaaagtaaaggaattgaaacagcagtcggagaag
gataagaaaagcaagttgaaatctgttaataaaaagcatactaacgatgaagaggagatc
gaaaagaatgccaaatcaaaggctgaattggagcttttaatggatgatgatgatgatacc
gaaactcagggcacaataaataacaaagcacatttcaacatgaacgaaatcttaagatca
gaaaaagaaaaacacaagaaaggccggtatcaaaagaaagagagaattgttgaagacacc
tttacacctgatttagaagatcctagatttaaagaagtcttcgaagatcacgattttgct
atcgacccgacccagcctgaattcaaaggtacacaagctatgagtaaaatcctaaaagaa
cgtagtaaacgtgttaagaataagaaaagaaaacttggcggtagtgaaaacaatatgacc
aataacgcagatgataatgaagatattggtaacttggtaaacaagttgaaaaagaaaagc
aaatcatccaagaaggtaaaggtttaa

Protein sequence

>851969 : length: 628
MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDDYVSSSDEFTSSDSESS
GESEVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER
VAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDA
DKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM
TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD
FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDMEITFTPALEGG
NEKSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEEEI
EKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDT
FTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMT
NNADDNEDIGNLVNKLKKKSKSSKKVKV



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min