Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

851988, YRA1

Organisms

Yeast (4932)

Synonyms

YDR381W;
SHE11;
Yra1p

Description

Nuclear protein that binds to RNA and to Mex67p, required for export of poly(A)+ mRNA from the nucleus; member of the REF (RNA and export factor binding proteins) family; another family member, Yra2p, can substitute for Yra1p function

Xrefs

SGD:S000002789

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 851988 PMID: 15584090
854948 851988 PMID: 15584090

Sequence Information

Nucleotide sequence

>851988 : length: 681
atgtctgctaacttagataaatccttagacgaaatcattggctctaacaaagcaggaagt
aatagagcccgtgtcggtggtactcgtggtaacggtccaagaagagttggtaagcaagtt
ggtagccaacgtaggagccttccaaacagaagaggccctatcagaaaaaatactagggca
cctccaaacgcagtcgctagagttgccaagctcttggacaccactagagaggtcaaggtc
aacgtcgaaggtttgccaagggacattaagcaggatgctgtaagagaattttttgcatct
caagtaggtggtgttcaaagagttttgttgagttataacgaaaggggccaatctactggt
atggctaacatcacattcaaaaacggtgaattggccagaagggctgttgaaagatttaac
ggctctccaatcgatggaggcagatcaagattgagacttaacctaatcgttgatccaaac
caacgcccagtcaaaagtttagccgacaggatcaaggctatgccacaaaaaggcggaaac
gctccaagaccagtaaagaggggtccaaatagaaaagctgctatggcaaaatcccaaaac
aaaccaaagagagaaaagcctgctaagaaaagtcttgaagatctggacaaggaaatggcg
gactatttcgaaaagaaataa

Protein sequence

>851988 : length: 226
MSANLDKSLDEIIGSNKAGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKNTRA
PPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTG
MANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPNQRPVKSLADRIKAMPQKGGN
APRPVKRGPNRKAAMAKSQNKPKREKPAKKSLEDLDKEMADYFEKK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min