Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852080, SDC1

Organisms

Yeast (4932)

Synonyms

YDR469W;
CPS25|SAF19;
Subunit of the COMPASS (Set1C) complex, which methylates histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; has similarity to C. elegans Dpy-30

Description

Sdc1p

Xrefs

SGD:S000002877

Chromosome

IV : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 852080 PMID: 10688190

Sequence Information

Nucleotide sequence

>852080 : length: 528
atgaatgaaagtgagaatagtccccaacataatgaagttacggttcctatggtagaggat
acttcaagtaatgctgatattccaatggagcaaattcaacgcgaagacaataagaactac
gataaacatgacaatgaatgcttcgatatgaatggcaatcacaataataactctgataac
ttacaatttgacagtgtaccatcttctgcaacgaaagatttgaaaaacatcaaaagtgtc
accaaccaaaatgtaaaaatagaagaatcgagtagcacaaattcagtcattgaagagtca
tctgaacctaaaatatcaaaattagaaaatgtgaaccttgccgcgacggtaggtggttca
caaactagaaaatacctgaatacaaatgtgacaccgcatttattagcgggcatgaggctc
atagccgtacaacaaccagaagatccgttacgtgttttaggtgaatatctaatcgagcag
agcaatatactgaagagtggagaaaaagagagtaatgctagtaaatga

Protein sequence

>852080 : length: 175
MNESENSPQHNEVTVPMVEDTSSNADIPMEQIQREDNKNYDKHDNECFDMNGNHNNNSDN
LQFDSVPSSATKDLKNIKSVTNQNVKIEESSSTNSVIEESSEPKISKLENVNLAATVGGS
QTRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSNILKSGEKESNASK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min