Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852218, SKT5

Organisms

Yeast (4932)

Synonyms

YBL061C;
CAL2|CHS4|CSD4;
Skt5p

Description

Activator of Chs3p (chitin synthase III), recruits Chs3p to the bud neck via interaction with Bni4p; has similarity to Shc1p, which activates Chs3p during sporulation

Xrefs

SGD:S000000157

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 852218 PMID: 16429126

Sequence Information

Nucleotide sequence

>852218 : length: 2091
atggcaagttcaccgcaggtacatccatataagaagcatttaatgcaatcacagcatata
aattttgataacaggggcctacagtttcaaaacagttcgttgaaggtaggtcaagatttt
tcagataataaagagaatagggaaaacagggacaatgaagacttcagtaccgcagacctt
cctaagcggtcggcaaaccaaccgcttatcaatgagcatcttagagctgcgtcagtacct
ctactatcaaacgatataggcaatagtcaagaggaagatttcgttccagtcccaccccca
cagcttcatcttaataattcaaataatacttccttaagttctttgggaagtactcctaca
aattctccgtcaccgggagcattaagacagacaaattcgagtacatctcttacgaaggag
caaataaagaaaagaactcgttctgtagatttgtctcacatgtacctgttgaatggtagc
agtgatacccaattaacggctactaatgaatctgtagcagatttgtcacatcagatgatc
agtcgatatttgggtggtaaaaataatacttccttagttccaaggctaaaaacaatagaa
atgtatagacaaaacgttaaaaaatctaaagatcctgaagtgttattccagtatgcgcaa
tatatgttacaaaccgcactgactattgaatcttccaatgctcttgttcaagatagtgac
aaggaaggaaatgtcagccaatctgacttaaaacttcagtttttgaaagaagcgcaaagt
tatttgaagaaactgagcataaagggttattcagatgcccaatacttattagcggacggc
tactcatccggagcatttgggaagattgaaaataaagaagcatttgtcttatttcaagca
gctgcaaagcatggtcatatagaaagtgcttacagagcatcgcattgcttagaagaagga
ctaggaacaacaagagattctcgtaagtcagtcaattttttaaagtttgcggctagcagg
aatcatccctcagcaatgtataaattgggactttattcattctacggcagaatgggtctt
ccaaccgacgttaatactaaattaaatggggtaaaatggttatcaagggctgcagcaaga
gctaatgagttgacggccgcagcaccatacgaattggctaagatttatcatgaagggttc
ttagatgttgtcattccggatgaaaagtatgcaatggaactatatattcaagcagcaagt
ttagggcatgttccttcagcaactttgttggcacagatttatgaaacaggtaatgataca
gtagggcaggatacatcactttctgtacactattatacgcaggcagcgttaaaaggcgat
tctgtggcaatgttaggtttatgtgcatggtacttactgggagcagaacctgcttttgaa
aaagatgaaaatgaggcttttcaatgggccttgcgtgcagctaatgctggtttgccaaag
gcccaattcactctgggctacttctatgagcatggcaagggctgtgatcgtaacatggaa
tacgcatggaaatggtacgagaaagctgcagggaacgaggacaagagggcgattaataag
ctacgctcaagggacggtggactagccagcattggtaaaaaacagcataaaaaaaataaa
agtatcagtactttgaatttattctctactgtggacagtcaaacaagtaacgtagggtca
aattcaagagtttcttcaaaatctgaaacattctttactggaaatccaaaacgtgatcgt
gagccacaaggtttgcaaattaacatgaattcaaacacgaatagaaatggtattaaaacg
ggttctgatacaagcatcaggaaaagttcttcctcagcaaagggaatgtcaagggaagtt
gctgagcagtcgatggcagcaaagcaagaagttagtttatcaaatatgggcagttcaaac
atgattcgtaaagattttcctgcagtaaaaactgagtcaaaaaaacctacaagcttgaag
aacaagaaggataaacaaggtaaaaaaaaaaaagactgtgtaattatgtaa

Protein sequence

>852218 : length: 696
MASSPQVHPYKKHLMQSQHINFDNRGLQFQNSSLKVGQDFSDNKENRENRDNEDFSTADL
PKRSANQPLINEHLRAASVPLLSNDIGNSQEEDFVPVPPPQLHLNNSNNTSLSSLGSTPT
NSPSPGALRQTNSSTSLTKEQIKKRTRSVDLSHMYLLNGSSDTQLTATNESVADLSHQMI
SRYLGGKNNTSLVPRLKTIEMYRQNVKKSKDPEVLFQYAQYMLQTALTIESSNALVQDSD
KEGNVSQSDLKLQFLKEAQSYLKKLSIKGYSDAQYLLADGYSSGAFGKIENKEAFVLFQA
AAKHGHIESAYRASHCLEEGLGTTRDSRKSVNFLKFAASRNHPSAMYKLGLYSFYGRMGL
PTDVNTKLNGVKWLSRAAARANELTAAAPYELAKIYHEGFLDVVIPDEKYAMELYIQAAS
LGHVPSATLLAQIYETGNDTVGQDTSLSVHYYTQAALKGDSVAMLGLCAWYLLGAEPAFE
KDENEAFQWALRAANAGLPKAQFTLGYFYEHGKGCDRNMEYAWKWYEKAAGNEDKRAINK
LRSRDGGLASIGKKQHKKNKSISTLNLFSTVDSQTSNVGSNSRVSSKSETFFTGNPKRDR
EPQGLQINMNSNTNRNGIKTGSDTSIRKSSSSAKGMSREVAEQSMAAKQEVSLSNMGSSN
MIRKDFPAVKTESKKPTSLKNKKDKQGKKKKDCVIM



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min