Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852245, POL12

Organisms

Yeast (4932)

Synonyms

YBL035C;
Pol12p

Description

B subunit of DNA polymerase alpha-primase complex, required for initiation of DNA replication during mitotic and premeiotic DNA synthesis; also functions in telomere capping and length regulation

Xrefs

SGD:S000000131

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 852245 PMID: 16429126

Sequence Information

Nucleotide sequence

>852245 : length: 2118
atgagcggatctatcgatgtcatcactcattttgggcctgatgcagacaagccggaaatc
atcactgcattagagaatttaactaaactgcatgcattgtccgtcgaggatctatacatt
aaatgggagcagttctccaatcaaaggcgtcaaactcacacagatctgacttccaagaac
atagatgagtttaaacaatttttacaattacaaatggaaaagcgtgctaaccaaatttca
tcgtcctctaaggtaaacacatccacaaaaaaaccagtgattaaaaaaagtttgaattca
agtcccttgtttggccttagtattccaaagactccgactttaaaaaaaagaaagttacat
ggtcccttttcactcagtgattccaagcaaacatataatgtaggctctgaggcagaaaca
aatgaaaaaggaaatagttctttaaaattggagtttactccaggcatggcagaagatgct
gtgggtgacagtgctccattgtcccacgctaaaagctcggatgccaagactcccggctcg
tcgacattccaaactccaacaacaaacactcctaccacatcgaggcaaaatgttcctgct
ggtgaaattttggattctttgaaccctgaaaatattgaaatatcatctggtaatccaaat
gtaggccttctttcgactgaagaaccatcatataaccaggtcaaagtagaaccattttat
gatgctaaaaagtataaattcagaacaatgaggcaaaacttacaggaagcgtctgatgtc
ctcgatgatcaaattgaatcgtttactaagattattcaaaatcactataagttatctcca
aacgacttcgctgatccaactattcaatctcagtccgaaatttatgctgttggaaggata
gttccagattcgccgacctacgacaagtttttgaatccagaatcgctttccctagagacc
tcaagaatgggcggcgttggaagaagggtaaggttagatctatcgcaggtcaacgagctt
tcgtttttcttaggccaaattgtggcattcaaaggtaaaaatgctaatggggattacttc
accgttaactctattttgccgctaccttatccaaactccccagtgtccacatcgcaggaa
ctgcaggagtttcaagcaaatttggaaggttcttctttgaaggttatcgtgacctgtggc
ccatactttgcaaatgataacttctccctcgaattgttgcaagaatttatcgatagtata
aataatgaggtaaaacctcacgtcttgataatgtttggcccatttatagatatcacccat
cctctgatagcgagtggtaaattgccaaattttccccagttcaagacacagcccaaaaca
ttggacgagctttttttgaagttatttactcctattctaaaaaccatatcaccacatatc
caaaccgtattgataccctccacaaaagatgcaatttctaatcacgccgcatatccacaa
gcttctttaattagaaaggctttacagctgcctaaaaggaacttcaaatgcatggctaat
ccttcatcttttcaaataaatgagatatacttcggttgctcaaacgttgatacattcaaa
gatctaaaggaagtcataaaaggcggtactacctcatcaagatatagattagatcgtgtt
tctgagcatattttacaacagcgcaggtattaccccatatttccaggtagtattcgtaca
agaataaaaccaaaagacgtatctacgaagaaggaaaccaatgatatggaaagcaaagaa
gaaaaagtttatgaacatatatctggtgcagatttagacgtgagttatctgggactaaca
gagtttgttggtgggttctcgcctgacataatgattatacccagtgaattacaacacttt
gcaagagttgtccaaaacgtagttgttataaatcccggaagatttattagagcaacaggt
aacaggggatcctatgcacaaattactgtccaatgccctgatcttgaagacgggaaattg
acgcttgttgaaggtgaagagccagtttatctacacaacgtgtggaagcgcgctagagtt
gacttgattgctagttga

Protein sequence

>852245 : length: 705
MSGSIDVITHFGPDADKPEIITALENLTKLHALSVEDLYIKWEQFSNQRRQTHTDLTSKN
IDEFKQFLQLQMEKRANQISSSSKVNTSTKKPVIKKSLNSSPLFGLSIPKTPTLKKRKLH
GPFSLSDSKQTYNVGSEAETNEKGNSSLKLEFTPGMAEDAVGDSAPLSHAKSSDAKTPGS
STFQTPTTNTPTTSRQNVPAGEILDSLNPENIEISSGNPNVGLLSTEEPSYNQVKVEPFY
DAKKYKFRTMRQNLQEASDVLDDQIESFTKIIQNHYKLSPNDFADPTIQSQSEIYAVGRI
VPDSPTYDKFLNPESLSLETSRMGGVGRRVRLDLSQVNELSFFLGQIVAFKGKNANGDYF
TVNSILPLPYPNSPVSTSQELQEFQANLEGSSLKVIVTCGPYFANDNFSLELLQEFIDSI
NNEVKPHVLIMFGPFIDITHPLIASGKLPNFPQFKTQPKTLDELFLKLFTPILKTISPHI
QTVLIPSTKDAISNHAAYPQASLIRKALQLPKRNFKCMANPSSFQINEIYFGCSNVDTFK
DLKEVIKGGTTSSRYRLDRVSEHILQQRRYYPIFPGSIRTRIKPKDVSTKKETNDMESKE
EKVYEHISGADLDVSYLGLTEFVGGFSPDIMIIPSELQHFARVVQNVVVINPGRFIRATG
NRGSYAQITVQCPDLEDGKLTLVEGEEPVYLHNVWKRARVDLIAS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min