Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852248, HEK2

Organisms

Yeast (4932)

Synonyms

YBL032W;
KHD1;
RNA binding protein with similarity to hnRNP-K that localizes to the cytoplasm and to subtelomeric DNA; required for the proper localization of ASH1 mRNA; involved in the regulation of telomere position effect and telomere length

Description

Hek2p

Xrefs

SGD:S000000128

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 852248 PMID: 16429126
851152 852248 PMID: 16429126

Sequence Information

Nucleotide sequence

>852248 : length: 1146
atgtcacagttcttcgaagctgctactcccgttgcaattcccacaaacaataccaacggc
ggctccagtgatgccggcagcgccgccactggcggcgcccccgttgttggcaccaccgct
caacccaccatcaatcacaggcttttgctgtcattgaaagaggctgccaagatcattggc
actaagggctccaccatctcacgcataagagctgcaaacgccgtcaagatcggtatttct
gaaaaggtgcccggttgctctgacaggatcctgtcctgtgctgggaacgtaatcaatgtg
gccaatgccattggtgatattgttgacgtgcttaacaaacggaatcccgaaaatgaggac
gcagctgagggcgaagcggaagagcactactacttccactttttgaaccatattttacca
gctccctcaaaggacgagatcagagatctgcagcaactggaggacatcggttatgtgagg
ctcattgtggccaattcccatatctcatcgattatcgggaaagcaggcgccaccatcaag
tccctgatcaataagcacggcgttaagatcgtggcttccaaggacttcttacctgctagc
gacgagagaattatcgagatccagggtttcccaggatccatcaccaatgtacttatcgaa
attagcgagatcatcttgagtgacgttgacgtcagattcagcacagaaagatcttatttc
cctcatctgaaaaagtcctccggtgagccaacttccccttctacctcatctaacactagg
atcgaattgaagattccagaactgtatgtaggcgccattattggccgtggaatgaacaga
attaagaatttgaaaactttcacaaaaaccaatattgtcgtggaaaggaaggatgacgat
gataaagacgaaaattttagaaaattcataatcacaagtaaatttcctaagaatgtcaaa
cttgctgagtccatgcttttgaagaacctgaatactgaaattgagaaacgtgaaaactac
aagagaaaattggaagctgccgaaggagatgccactgttgttactgaacgctctgattct
gcttctttcttggaagagaaggaagaacctcaagagaatcatgataacaaagaggagcag
tcgtag

Protein sequence

>852248 : length: 381
MSQFFEAATPVAIPTNNTNGGSSDAGSAATGGAPVVGTTAQPTINHRLLLSLKEAAKIIG
TKGSTISRIRAANAVKIGISEKVPGCSDRILSCAGNVINVANAIGDIVDVLNKRNPENED
AAEGEAEEHYYFHFLNHILPAPSKDEIRDLQQLEDIGYVRLIVANSHISSIIGKAGATIK
SLINKHGVKIVASKDFLPASDERIIEIQGFPGSITNVLIEISEIILSDVDVRFSTERSYF
PHLKKSSGEPTSPSTSSNTRIELKIPELYVGAIIGRGMNRIKNLKTFTKTNIVVERKDDD
DKDENFRKFIITSKFPKNVKLAESMLLKNLNTEIEKRENYKRKLEAAEGDATVVTERSDS
ASFLEEKEEPQENHDNKEEQS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min