Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852283, HTA2

Organisms

Yeast (4932)

Synonyms

YBL003C;
H2A2;
One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p

Description

Hta2p

Xrefs

SGD:S000000099

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 852283 PMID: 16429126

Sequence Information

Nucleotide sequence

>852283 : length: 399
atgtccggtggtaaaggtggtaaagctggttcagctgctaaagcttctcaatctagatct
gctaaagctggtttaacattcccagttggtagagtgcacagattgctaagaagaggtaac
tacgcccagagaattggttctggtgctccagtctatctaactgctgtcttagaatatttg
gctgctgaaattttagaattggctggtaatgctgctagagataacaaaaaaaccagaatt
attccaagacatttacaattggccatcagaaatgatgatgaattgaacaagctattgggt
aatgttaccatcgcccaaggtggtgttttgccaaacattcaccaaaacttgttgccaaag
aagtctgccaagactgccaaagcttctcaagaactgtaa

Protein sequence

>852283 : length: 132
MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPK
KSAKTAKASQEL



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min