Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852344, PRP6

Organisms

Yeast (4932)

Synonyms

YBR055C;
RNA6|TSM7269;
Splicing factor, component of the U4/U6-U5 snRNP complex

Description

Prp6p

Xrefs

SGD:S000000259

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

853272 852344 PMID: 11805837
851152 852344 PMID: 11805837

Sequence Information

Nucleotide sequence

>852344 : length: 2700
atggagaggccatcttttttggatcaagaaccacctgcaggttacgtaccaggtattggt
cgtggagccactggattttcaacaaaagaaaagcaagtggttagtaatgatgacaaagga
agaagaataccgaaaaggtaccgtgaaaatttgaacaaccatcttcaaagccaaccgaaa
gatgatgaagatgatgaagctgcaaatgtattcaaaacgcttgaattgaaattagcacaa
aagaaaaagaaaagagctaatgaaaaggatgatgacaattcagttgattcttcaaacgtg
aaacggcaatttgccgatttgaaagaatcattagctgctgtaacggagagtgagtggatg
gatattccggatgccacagattttacaagaagaaacaagagaaatagaattcaagagcaa
ttaaacagaaaaacttatgctgcaccggattcgctaatacctgggaatgttgatttaaat
aaattaacggaagaacgagaaaaattattgcaatctcaaatagatgagaatcttgcacaa
ttaacgaagaatgcaagtaaccctatacaggttaataaaccgaacgctgctaccgatgcc
ctaagttacttaaaggacttagaaaacgatagagtaaattctctctcagacgcaacgtta
gaagatttacagaaaatgcgcacaattttaaagtcatacagaaaggccgatccaacaaat
ccacagggttggatagcttctgccagattagaagaaaaggcaagaaaattttcagtagca
aaaaaaataatagaaaatggttgccaagagtgccctcgaagctccgatatttggctagaa
aacattagactacacgaatctgatgttcactactgtaaaacattagtggcaacggcaata
aattttaatccaacgtctccgcttctttggttcaaagctattgatttggaaagcacaacg
gttaacaaatatagagtagtgagaaaagcactgcaagagattcctcgagatgagggccta
tggaagctagctgtcagttttgaagctgacaaagcgcaagttataaaaatgttagagaaa
gccacacaatttattccacaaagtatggatctcttgactgcatatactaatttgcaaagc
tatcataatgctaaaatgactttgaattccttcagaaaaatccttccgcaagaaccggaa
atttggattatctctacactcttggaagaacgaaataacccagatatacctgtagataaa
ctagttagtttgctcaaggagggtttattggaactctctaaaaatgggtacaaagcgacc
ttgtcagcatggttgaaacgtgcagaggctctaaatgatgcgcccaattcaaatttaacc
tgtcaagccatcgtttacgctatattagaatggttaagagaaagtggcgagtatgagtct
gagttgaataatgttgatcagatattagaaaaaatgccacactcaaaggtacaaattgct
gtcttaaaaaagcttattcagtgggatccttgtgatacagttctttggtctagactgaaa
atggccactgaaagctaccataaaattgaagagttattagcatttttccaggagctgcta
tttcagaccaagaatagtgatgatatacgagcaaatatgagggagaaaagccctggcttg
ttaatgatgtatgtaagcgaatattggaaggcccaaaaaggggatactaggcaaacacta
gttttgattgaccagattatagatttcgccccgcataatttggatttacgctttttcaag
ataaagttattaggtcgttcactacaacttgatgaattacgagatttttttcagcaaact
ttctcctctttagaggattttaagatcagtggcacggaaagattatattataaatacgta
aactttctgcggtaccaagatctgaatgaagaggctataaaattcttgaatgagagatgt
ttgaaatcatttcccatctgccacaaattttttttacagctgggtcaaatttatcattcc
atgggcaatattgaaatgagtagagaaacctatttgtctggtacaaggttagtgcccaat
tgccctttattatgggtttccctatcaaagattgacgagattgatctaaaaaatccagta
agggcaagatcaattttagatagaggattgttaaaaaatcctgacgatgtattattttac
attgctaaaatccaaatggaaataagacttggtaacttagatcaggcggagttactcgtc
acacaggcattgcaaaagtttccaagcaatgctttactttgggtggagcaaatcaagctg
tttaagcatggaaacaaaagttcgttaaaaaaaacaatttttcaagatgctttaagaagg
acacaaaacgatcatcgcgttcttttggagattggagtatccttttatgcagaagcgcaa
tatgaaacatcattaaaatggttagaaagagctctgaaaaagtgctcgcgttacggagat
acatgggtttggctatttaggacatatgcaaggttaggcaaggatactgttgatctctac
aatatgttcgatcaatgtgagcctacttacggacccgaatggatagccgcctccaagaac
gtaaaaatgcaatactgcacacctagagagattttattgcgcttgatgaatgacaaataa

Protein sequence

>852344 : length: 899
MERPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPK
DDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWM
DIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQ
LTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTN
PQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDVHYCKTLVATAI
NFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEK
ATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDK
LVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYES
ELNNVDQILEKMPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELL
FQTKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFK
IKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERC
LKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPV
RARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKL
FKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGD
TWVWLFRTYARLGKDTVDLYNMFDQCEPTYGPEWIAASKNVKMQYCTPREILLRLMNDK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min