Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852439, MAK5

Organisms

Yeast (4932)

Synonyms

YBR142W;
Mak5p

Description

Essential nucleolar protein, putative DEAD-box RNA helicase required for maintenance of M1 dsRNA virus; involved in biogenesis of large (60S) ribosomal subunits

Xrefs

SGD:S000000346

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 852439 PMID: 16429126

Sequence Information

Nucleotide sequence

>852439 : length: 2322
atgggtaagaaaagggctcctcaaaaaggaaaaacggtcacaaagccacaggagataatt
gtagatgaatccaaattgaactggaaaccagtagatattccggacactttagatgacttt
ggtggattttatggcttggaagaaattgacggagtggacgttaaagtcgtggatggtaaa
gtaactttcgtcaccaaaaaagattcaaaagtgttaaaagatagcaataaggaaaaagtc
ggagatgatcaggaatctgtggaaaatgaatcagggtcagattcggagtccgagctcctt
gaattcaagaacttggacgatattaaagaaggagagttgagtgcagcatcttattcatca
tccgacgaggatgagcaaggtaatattgagagttcaaagttaaccgatcccagtgaggat
gtggatgaggatgtggatgaggatgttttgaaagaaaacgtctttaacaaagacattaat
atcgatgatatttctcctgtaaatttacctgaatggacgaatcttgcacctctctcaatg
actattttgcagagcttgcagaatttaaattttctcagacctacagaaattcaaaaaaag
tctattccagttattatgcaaggcgtagacgtcatggggaaagcctctacaggttcaggt
aaaactttagcctatggtattccaattgtagagaaactgatcagtaacttctctcagaaa
aacaagaaaccaatatcgttaatctttactcctacaagagaactggcgcatcaagtcaca
gaccacttaaaaaagatctgtgagcctgttctagcgaaatctcagtactcgatattatct
ttgacaggtggactctctatccaaaaacaacaacgtctattaaagtacgataatagtggc
caaattgtcatcgcaacaccaggtagatttttggaactgttggaaaaagacaacacttta
atcaaaagattctcgaaagtaaatacgctaatccttgatgaggctgataggctgttacaa
gacggtcatttcgacgagttcgaaaaaatcattaaacatttattagtagaaagaaggaaa
aacagagaaaactccgagggcagtagcaaaatttggcaaactttgatcttttctgcaaca
ttctccatcgacttgtttgataagctatcttcttcccgtcaagttaaggatagaaggttt
aaaaacaacgaagatgagctaaatgccgtaatacaacacttaatgagcaaaattcacttc
aactcaaagccggttataatagatacaaatcctgagtcaaaagtgagctctcaaatcaaa
gaatccttaattgaatgtcctccattagaacgtgacctatactgctattactttttaacc
atgttcccaggtacaactttgatcttttgtaatgccattgactccgtgaagaaattgacc
gtatacttaaataacctaggcatcccagcttttcaaattcattcttccatgacacaaaag
aaccgtttgaaaagcttagaaaggttcaagcaacaaagcgctaaacagaaaacaataaat
cattcgaatccggattccgttcaactctcaacagtattgattgcaagtgatgttgctgct
agaggtttagatattccgggtgttcaacacgttattcattaccacttaccaagatctact
gatatttatattcatagatcaggcagaactgcaagagcaggttctgaaggtgtctctgcc
atgatatgctcacctcaagaatctatgggcccattaagaaagttaagaaaaactctcgct
acaaaaaatagtgtttcgacggatttgaactctagatcaactaacagaaaacccatcaag
tggcaaaacactgtgcctttgttaccaattgaaaccgatatactttcacaactcagagaa
agaagtagattagcaggcgaactggctgatcatgaaattgcttctaattccctaagaaaa
gatgacaattggttaaaaaaggctgctgatgaattaggtattgacgttgattccgacgaa
gacgatatatcaaagagtaattcggacactttcttactaaaaaataaaaataaaaaaatg
cagaagactataaataaggacaaggtaaaagccatgagagctacgttgaacgaattgtta
tcagtgcctatacgtaaagatagaagacagaaatatttgacaggtgggctagtgaattta
gctgataacttggtcaaaaaaagaggtcataattctatcattggtcatgaaaagacaaac
gccttagaaactttgaagaaaaagaaaaagagaaataattaa

Protein sequence

>852439 : length: 773
MGKKRAPQKGKTVTKPQEIIVDESKLNWKPVDIPDTLDDFGGFYGLEEIDGVDVKVVDGK
VTFVTKKDSKVLKDSNKEKVGDDQESVENESGSDSESELLEFKNLDDIKEGELSAASYSS
SDEDEQGNIESSKLTDPSEDVDEDVDEDVLKENVFNKDINIDDISPVNLPEWTNLAPLSM
TILQSLQNLNFLRPTEIQKKSIPVIMQGVDVMGKASTGSGKTLAYGIPIVEKLISNFSQK
NKKPISLIFTPTRELAHQVTDHLKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSG
QIVIATPGRFLELLEKDNTLIKRFSKVNTLILDEADRLLQDGHFDEFEKIIKHLLVERRK
NRENSEGSSKIWQTLIFSATFSIDLFDKLSSSRQVKDRRFKNNEDELNAVIQHLMSKIHF
NSKPVIIDTNPESKVSSQIKESLIECPPLERDLYCYYFLTMFPGTTLIFCNAIDSVKKLT
VYLNNLGIPAFQIHSSMTQKNRLKSLERFKQQSAKQKTINHSNPDSVQLSTVLIASDVAA
RGLDIPGVQHVIHYHLPRSTDIYIHRSGRTARAGSEGVSAMICSPQESMGPLRKLRKTLA
TKNSVSTDLNSRSTNRKPIKWQNTVPLLPIETDILSQLRERSRLAGELADHEIASNSLRK
DDNWLKKAADELGIDVDSDEDDISKSNSDTFLLKNKNKKMQKTINKDKVKAMRATLNELL
SVPIRKDRRQKYLTGGLVNLADNLVKKRGHNSIIGHEKTNALETLKKKKKRNN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min