Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852487, RPS9B

Organisms

Yeast (4932)

Synonyms

YBR189W;
RPS13A|SUP46;
Rps9bp

Description

Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins

Xrefs

SGD:S000000393

Chromosome

II : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 852487 PMID: 17200106
851152 852487 PMID: 16429126

Sequence Information

Nucleotide sequence

>852487 : length: 588
atgccaagagctccaagaacttactctaagacttactctacaccaaagagaccttacgaa
tcttctcgtttggacgcagaattgaagttggccggtgaattcggtttgaagaacaagaga
gaaatttacagaatttctttccaattgtctaaaattcgtcgtgctgccagagacttgtta
actagagacgaaaaggacccaaagagattgttcgaaggtaatgccttgatcagaagattg
gttagagttggtgtcttgtccgaagacaagaagaagttggattatgttttggctttgaag
gttgaagatttcttggaaagaagattgcaaactcaagtctacaagttgggtttggccaag
tctgtccaccacgccagagttttaatcactcaaagacacattgctgttggtaagcaaatc
gtcaacatcccatctttcatggtcagattggactctgaaaagcacattgacttcgctcca
acttctccattcggtggtgctagaccaggtagagttgctagaagaaacgctgctagaaag
gctgaagcttccggtgaagctgctgaagaagccgaagacgaagaataa

Protein sequence

>852487 : length: 195
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAAEEAEDEE



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min