Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852702, KEM1

Organisms

Yeast (4932)

Synonyms

YGL173C;
DST2|RAR5|SEP1|SKI1|XRN1;
Kem1p

Description

Evolutionarily-conserved 5'-3' exonuclease component of cytoplasmic processing (P) bodies involved in mRNA decay; plays a role in microtubule-mediated processes, filamentous growth, ribosomal RNA maturation, and telomere maintenance

Xrefs

SGD:S000003141

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 852702 PMID: 16429126
854948 852702 PMID: 17200106
851152 852702 PMID: 16429126

Sequence Information

Nucleotide sequence

>852702 : length: 4587
atgggtattccaaaatttttcaggtacatctcagaaagatggcccatgattttacagctt
attgagggaacacagattcctgagtttgataacttatacctggatatgaattcgatttta
cataattgtacgcatggtaacgacgatgatgtaaccaagcgattaactgaagaagaggtt
tttgcaaaaatctgtacgtatatcgatcacctttttcaaacaatcaagcccaagaagatt
ttctacatggctattgatggtgtggcccctcgtgccaagatgaatcaacaaagagctcgt
agattcagaaccgctatggatgcagaaaaagccttgaagaaggctattgagaatggtgac
gagattcctaagggtgagccatttgattcgaattctattactccaggtacggagtttatg
gccaaattgaccaaaaacttacaatattttattcacgacaagatttctaacgattccaaa
tggagggaagtgcaaatcatattttctggccatgaagttccaggtgaaggtgaacacaag
atcatgaactttataaggcatttaaaatcccaaaaggatttcaaccagaatacgagacat
tgtatttacggtcttgacgcagatttgattatgctgggtttgtctactcatgggccacat
tttgcgttattgagagaagaagtgacatttggtagaagaaatagtgaaaaaaaatcgctt
gaacatcaaaatttctacttattacatctttctttattaagagaatacatggagttggaa
ttcaaagaaattgccgatgaaatgcaatttgaatacaattttgaacgtattttggatgat
tttattcttgtcatgttcgtcattggtaatgatttcttgcccaatttgccagatttgcac
cttaacaaaggagcatttcccgttttgttacaaacgttcaaagaagctcttttacatact
gatggctacattaatgaacatggtaaaataaatttaaagagattaggtgtctggttaaat
tatctgtctcaatttgagttattaaatttcgaaaaggatgatatagacgttgagtggttc
aacaagcaattagagaatatttctttggagggtgaaaggaaaagacagagggttggtaaa
aaattactggtaaaacaacagaagaaattaattggaagtataaaaccatggttgatggag
caattacaggaaaaattatcgcctgatttaccagatgaagaaattccaactttagagtta
cctaaggacttagacatgaaagatcatttagaatttttaaaagaattcgcttttgatttg
ggtctttttataacgcattccaaatccaaaggtagttattcgctaaaaatggatcttgat
tctattaatcctgatgaaacagaagaagaatttcaaaatcgtgttaattctatcaggaaa
acaataaaaaaatatcaaaatgctatcatcgtggaggacaaagaagaattggaaactgaa
aaaacgatttataatgaaaggtttgaacgttggaagcatgagtattatcacgacaagtta
aaatttacgacagacagtgaagaaaaagtgagagatcttgctaaagactacgttgaaggt
ttacaatgggttctatattattattatagaggatgtccatcttggtcgtggtactatccg
caccattatgcaccaagaatctccgacttagccaagggtttagatcaagacattgaattt
gatttgagcaaaccatttactccattccagcaactaatggcagttttaccggaaaggtcc
aaaaatctgatacctcccgcctttaggccattaatgtacgatgaacagtcgccaatccac
gatttctatcccgctgaggttcaacttgataaaaacggcaagacagctgattgggaagct
gtggttttgatatcgtttgtagatgaaaaaaggttgattgaggctatgcaaccttatttg
cgcaagttatcacctgaagaaaaaacgagaaatcaatttggcaaggacttgatatattcc
tttaatcctcaagttgataacctttataagagtccgttgggcggcattttttctgatatt
gaacacaatcattgtgtcgaaaaagagtacatcaccatcccattggacagctccgagatt
cggtatggtttattacctaatgctaaactcggtgccgaaatgctggcgggtttccccacg
ttattgtctttaccatttactagttcactggagtacaatgagacaatggttttccaacaa
ccttctaaacaacaatcaatggtcttacaaataactgacatatacaaaacgaataatgtt
actttggaggacttttccaagaggcatttaaacaaagtgatttatacaagatggccatat
ttaagagaatccaaattggtctctttaacggatggtaagactatctatgaatatcaggag
tccaatgataagaaaaagttcggattcataacgaagcctgcggaaacccaggacaaaaaa
cttttcaatagtttgaagaattcaatgctaaggatgtatgctaaacagaaagctgttaaa
ataggacctatggaagccattgctaccgtctttccagtgactggtttggtgagagactct
gatggtggttatattaagacctttagccctaccccagattactatccattgcaactggtt
gttgaatctgttgtcaacgaggatgaaagatataaagaaagaggacccattcctattgaa
gaggaatttccattgaattcaaaagttattttcttaggtgattatgcctatggtggtgaa
actactattgacggttacagcagtgaccgcagactaaaaattactgtagaaaagaagttt
ttggatagtgagcccaccatcggcaaagaaaggttacaaatggatcatcaagccgttaaa
tattatccgtcttatattgtgtccaagaacatgcacttacaccccttgtttttgtctaag
attacttccaagttcatgattactgacgctactgggaagcatatcaatgttggtatcccg
gttaagttcgaagctagacaccaaaaggttttaggttacgcgaggaggaaccctaggggc
tgggaatactcaaatttaactctaaatttactgaaagagtatagacaaactttcccagat
ttttttttcaggttgtccaaggtaggtaatgatatcccagttttggaagatcttttcccc
gatacttccactaaggatgccatgaatttattagatggtatcaaacaatggctaaagtat
gtctcatcgaagtttatcgcggtatctttggagtctgactccttaactaagacatcgatt
gctgccgtggaagatcatatcatgaaatacgcagctaacatcgaaggtcatgaaagaaaa
cagttagccaaagttcctcgtgaggctgttttgaatccaagatcatcatttgcactctta
cgtagtcaaaagttcgatttgggtgaccgtgttgtttatatccaagattctggtaaggta
ccaattttctcaaagggtacagttgttggctatactactctcagttcatcattatcaatt
caggtcttatttgatcatgaaatcgtggccggtaataattttggcggcaggttgcgcacg
aatagaggcttagggcttgatgcctctttcttattgaatattactaacaggcagttcatt
tatcactccaaggcttccaaaaaggctttggaaaagaaaaagcaatctaacaataggaac
aataataccaaaactgctcacaagactccttcaaagcaacaatctgaagaaaaactgaga
aaagaaagggcacatgatttattgaattttatcaaaaaggataccaatgaaaagaattct
gaaagtgtagacaacaagagcatgggatcgcaaaaagattccaaacccgcaaagaaagtt
ttgttaaaaagaccagctcagaaaagcagtgaaaacgtgcaagttgatttggccaatttt
gaaaaagcaccgcttgataatccaactgttgctggatctattttcaatgccgttgcaaat
caatattctgatggtataggcagtaatttgaatatcccaactccacctcacccaatgaat
gtggttgggggtcctattcctggagcgaatgatgttgcagatgttggtttgccgtacaat
attcccccaggttttatgacgcatcctaatggtcttcacccattacaccctcaccagatg
ccttaccctaatatgaatggaatgtctattccgccaccagcaccacatgggtttggacaa
ccgatttccttcccacctccacctcctatgacaaatgtttcagatcaaggaagtcgtatt
gttgtcaatgaaaaggaaagccaagatttgaaaaaattcattaatggtaaacagcacagc
aatggttcaactattgggggagaaacaaagaacagtaggaaaggcgagattaaaccttct
tctggcacaaactctactgaatgtcaatcgccaaagtcacaaagcaatgctgctgaccgt
gataataaaaaagacgaatctacttag

Protein sequence

>852702 : length: 1528
MGIPKFFRYISERWPMILQLIEGTQIPEFDNLYLDMNSILHNCTHGNDDDVTKRLTEEEV
FAKICTYIDHLFQTIKPKKIFYMAIDGVAPRAKMNQQRARRFRTAMDAEKALKKAIENGD
EIPKGEPFDSNSITPGTEFMAKLTKNLQYFIHDKISNDSKWREVQIIFSGHEVPGEGEHK
IMNFIRHLKSQKDFNQNTRHCIYGLDADLIMLGLSTHGPHFALLREEVTFGRRNSEKKSL
EHQNFYLLHLSLLREYMELEFKEIADEMQFEYNFERILDDFILVMFVIGNDFLPNLPDLH
LNKGAFPVLLQTFKEALLHTDGYINEHGKINLKRLGVWLNYLSQFELLNFEKDDIDVEWF
NKQLENISLEGERKRQRVGKKLLVKQQKKLIGSIKPWLMEQLQEKLSPDLPDEEIPTLEL
PKDLDMKDHLEFLKEFAFDLGLFITHSKSKGSYSLKMDLDSINPDETEEEFQNRVNSIRK
TIKKYQNAIIVEDKEELETEKTIYNERFERWKHEYYHDKLKFTTDSEEKVRDLAKDYVEG
LQWVLYYYYRGCPSWSWYYPHHYAPRISDLAKGLDQDIEFDLSKPFTPFQQLMAVLPERS
KNLIPPAFRPLMYDEQSPIHDFYPAEVQLDKNGKTADWEAVVLISFVDEKRLIEAMQPYL
RKLSPEEKTRNQFGKDLIYSFNPQVDNLYKSPLGGIFSDIEHNHCVEKEYITIPLDSSEI
RYGLLPNAKLGAEMLAGFPTLLSLPFTSSLEYNETMVFQQPSKQQSMVLQITDIYKTNNV
TLEDFSKRHLNKVIYTRWPYLRESKLVSLTDGKTIYEYQESNDKKKFGFITKPAETQDKK
LFNSLKNSMLRMYAKQKAVKIGPMEAIATVFPVTGLVRDSDGGYIKTFSPTPDYYPLQLV
VESVVNEDERYKERGPIPIEEEFPLNSKVIFLGDYAYGGETTIDGYSSDRRLKITVEKKF
LDSEPTIGKERLQMDHQAVKYYPSYIVSKNMHLHPLFLSKITSKFMITDATGKHINVGIP
VKFEARHQKVLGYARRNPRGWEYSNLTLNLLKEYRQTFPDFFFRLSKVGNDIPVLEDLFP
DTSTKDAMNLLDGIKQWLKYVSSKFIAVSLESDSLTKTSIAAVEDHIMKYAANIEGHERK
QLAKVPREAVLNPRSSFALLRSQKFDLGDRVVYIQDSGKVPIFSKGTVVGYTTLSSSLSI
QVLFDHEIVAGNNFGGRLRTNRGLGLDASFLLNITNRQFIYHSKASKKALEKKKQSNNRN
NNTKTAHKTPSKQQSEEKLRKERAHDLLNFIKKDTNEKNSESVDNKSMGSQKDSKPAKKV
LLKRPAQKSSENVQVDLANFEKAPLDNPTVAGSIFNAVANQYSDGIGSNLNIPTPPHPMN
VVGGPIPGANDVADVGLPYNIPPGFMTHPNGLHPLHPHQMPYPNMNGMSIPPPAPHGFGQ
PISFPPPPPMTNVSDQGSRIVVNEKESQDLKKFINGKQHSNGSTIGGETKNSRKGEIKPS
SGTNSTECQSPKSQSNAADRDNKKDEST



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min