Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852757, PRP43

Organisms

Yeast (4932)

Synonyms

YGL120C;
RNA helicase in the DEAH-box family, functions in both RNA polymerase I and polymerase II transcript metabolism, involved in release of the lariat-intron from the spliceosome

Description

Prp43p

Xrefs

SGD:S000003088

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

854948 852757 PMID: 16429126
851152 852757 PMID: 16429126

Sequence Information

Nucleotide sequence

>852757 : length: 2304
atgggttccaaaagaagattctcgtccgaacacccggatccagttgagacctctattcct
gagcaggccgccgagattgcggaagaattatccaaacagcatcctcttccatccgaagag
ccacttgtccatcatgatgctggtgaattcaagggcttgcaacgtcaccatacttcagca
gaagaggcccaaaaacttgaagatggaaaaataaatccatttaccggtagggagtttaca
ccaaaatatgttgatatcctgaaaattagaagagaattgccagtacatgcccagagagat
gagtttttaaaactttatcaaaataaccagattatggtttttgttggtgaaacaggttcc
ggtaaaacgacacaaattcctcaattcgttttattcgatgagatgccacacttagagaac
actcaagttgcatgtactcaacctcgtcgtgtcgcagcaatgtctgttgcacagagagtt
gctgaggaaatggatgtcaagttgggcgaagaagttggttattctatcagattcgaaaat
aaaacttctaataaaacgatattgaagtatatgactgatggtatgttgttgagagaggca
atggaagaccatgacttgtcgcgttattcatgtatcattctggatgaagcgcacgaacgt
acactagctactgatattttgatgggtcttttgaagcaagtagtcaagaggagacctgat
ttgaagataattattatgtctgctactctggatgcagagaagttccaacgctacttcaac
gatgctccattacttgccgttccgggcagaacatatccagttgagctatactatacaccg
gaatttcaaagggactatttagattctgccattcgtactgttttgcaaattcatgccact
gaagaggctggcgatattttgttatttttaactggtgaagatgaaattgaagacgctgtc
agaaagatttccttagaaggtgatcaattggttagagaagagggatgcggacctttatcc
gtatacccactgtatggttcattaccaccgcatcaacaacaaagaatattcgagcctgct
ccagagtcacataatggtagaccaggcaggaaagttgttatctccacgaacatcgctgaa
acttctttaacaattgatggtattgtctacgtcgttgacccaggattttcaaagcaaaaa
gtttacaatccaagaattagagttgagtctttacttgtttcccctatctccaaggcttct
gcccaacaaagagctggtcgtgctggtcgtacaaggcctggtaaatgtttcagattatac
actgaagaggcattccaaaaggaactgatagagcaaagttacccagaaattttacgttcc
aatttatcctccaccgttctagaactaaaaaaattaggtattgatgacttggtccatttc
gattttatggatccaccggctccggaaacaatgatgagagcccttgaagaactaaattat
ttggcatgtctggacgacgaaggtaacttaacacccctaggtagattggcatcccagttt
cccttggatcctatgctagcggtgatgttaattgggtcctttgagttccaatgttctcaa
gaaatactaactatagtggccatgctatcggttccaaacgtgtttattcgcccaacaaag
gacaagaagcgagcagatgatgccaagaatatctttgctcatccagacggtgatcatatc
accttactaaatgtatatcatgcgttcaaatcggatgaagcttatgaatatggtatccat
aagtggtgccgtgaccactatctaaattacaggtccctttccgctgctgataatatccgc
tcccaattagaaagattaatgaaccgttacaacctagaattaaacactacagactatgaa
agccctaaatactttgacaacatcagaaaggctcttgcgtctgggtttttcatgcaagta
gcaaaaaaaagatcgggagctaaaggatacatcacagttaaagataaccaagatgttctg
atccatcctagtacggttcttggccacgacgcagaatgggtcatttacaatgaatttgtg
ctcacatcgaagaactacataagaactgtgacctcggtcaggcccgaatggctgattgaa
atagcgcctgcatactacgacttaagcaatttccaaaaaggtgatgtcaaattatctttg
gaaaggatcaaggaaaaagttgatagattaaacgagttgaaacaaggtaaaaacaaaaag
aagagtaagcactccaagaaatag

Protein sequence

>852757 : length: 767
MGSKRRFSSEHPDPVETSIPEQAAEIAEELSKQHPLPSEEPLVHHDAGEFKGLQRHHTSA
EEAQKLEDGKINPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGS
GKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFEN
KTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPD
LKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHAT
EEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPA
PESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKAS
AQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHF
DFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQ
EILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIH
KWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQV
AKKRSGAKGYITVKDNQDVLIHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIE
IAPAYYDLSNFQKGDVKLSLERIKEKVDRLNELKQGKNKKKSKHSKK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min