Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852804, RPL7A

Organisms

Yeast (4932)

Synonyms

YGL076C;
Rpl7ap

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Bp and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)

Xrefs

SGD:S000003044| SGD:S000007302

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851726 852804 PMID: 16429126
854681 852804 PMID: 16429126
854948 852804 PMID: 17200106
851152 852804 PMID: 16429126
851152 852804 PMID: 17200106

Sequence Information

Nucleotide sequence

>852804 : length: 735
atggccgctgaaaaaatcttgaccccagaatctcagttgaagaagtctaaggctcaacaa
aagactgctgaacaagtcgctgctgaaagagctgctcgtaaggctgctaacaaggaaaag
agagccattattttggaaagaaacgccgcttaccaaaaggaatacgaaactgctgaaaga
aacatcattcaagctaagcgtgatgccaaggctgctggttcctactacgtcgaagctcaa
cacaagttggtcttcgttgtcagaatcaagggtattaacaagatcccacctaagccaaga
aaggttctacaattgctaagattgacaagaatcaactctggtacattcgtcaaagttacc
aaggctactttggaactattgaagttgattgaaccatacgttgcttacggttacccatcg
tactctactattagacaattggtctacaagagaggtttcggtaagatcaacaagcaaaga
gttccattgtccgacaatgctatcatcgaagccaacttgggtaagtatggtatcttgtcc
attgacgatttgattcacgaaatcatcactgttggtccacacttcaagcaagctaacaac
tttttgtggccattcaagttgtccaacccatctggtggttggggtgtcccaagaaagttc
aagcactttatccaaggtggttctttcggtaaccgtgaagaattcatcaacaaattggtt
aagtccatgaactaa

Protein sequence

>852804 : length: 244
MAAEKILTPESQLKKSKAQQKTAEQVAAERAARKAANKEKRAIILERNAAYQKEYETAER
NIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVT
KATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILS
IDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLV
KSMN



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min