Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852810, RPB9

Organisms

Yeast (4932)

Synonyms

YGL070C;
SHI1|SSU73;
Rpb9p

Description

RNA polymerase II subunit B12.6; contacts DNA; mutations affect transcription start site; involved in telomere maintenance

Xrefs

SGD:S000003038

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 852810 PMID: 11441018

Sequence Information

Nucleotide sequence

>852810 : length: 369
atgactacgtttagattttgtcgtgactgcaacaatatgttgtaccctcgtgaggataaa
gaaaataaccggttgttatttgaatgcagaacatgctcgtatgtagaagaagcgggcagt
ccattggtctacaggcatgaattgattaccaacattggtgaaactgcgggagtggtgcaa
gatattggttccgatcccactcttccgagatctgatagagaatgtcccaaatgtcactct
cgggaaaatgtgttttttcaatcacaacaaagaagaaaggatacttcgatggttttattc
tttgtgtgcttatcttgctcacacatatttacttcagatcaaaaaaacaaaaggacgcag
ttttcatga

Protein sequence

>852810 : length: 122
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min