Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852838, RNA15

Organisms

Yeast (4932)

Synonyms

YGL044C;
Rna15p

Description

Cleavage and polyadenylation factor I (CF I) component involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p

Xrefs

SGD:S000003012

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 852838 PMID: 16429126

Sequence Information

Nucleotide sequence

>852838 : length: 891
atgaataggcagagcggtgtgaatgcgggggtacagaacaacccaccatcccgagtggtg
tatctgggttctataccatacgatcaaacagaggagcagatacttgatttatgtagtaat
gttgggcccgtgatcaatttgaaaatgatgttcgacccccaaactggtaggtcgaaaggg
tacgcgtttattgaatttagagatttagagtccagtgccagcgcagtacgtaatttgaat
ggataccaattaggctctaggtttttgaaatgcggttactccagcaatagtgatatatcg
ggagtttcacaacagcaacaacaacagtacaacaacattaatgggaacaataacaacaat
ggaaataataataataatagtaatgggccggactttcaaaacagcggaaatgccaatttt
ctaagtcaaaagtttccagaattgccctctggtatcgacgttaacataaacatgaccacc
cctgctatgatgatatcgagcgaactagctaaaaaaccgaaagaggtgcagttgaaattt
ttacaaaaattccaagaatggacaagagcgcatcctgaagatgctgtttcgctattagag
ctgtgtccacagttgagttttgttacggctgaattattgctaacgaatgggatatgtaaa
gtggatgatttgatcccgttagcttccaggccgcaagaagaggcatcggctacgaataac
aatagcgtgaacgaggtggtggatccagctgtgcttaacaaacagaaagaactactgaaa
caggtgttacaactgaatgacagtcaaatttctatcttgcccgatgatgaaaggatggct
atttgggacttaaaacaaaaagcattaaggggagaatttggtgcattttga

Protein sequence

>852838 : length: 296
MNRQSGVNAGVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKG
YAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISGVSQQQQQQYNNINGNNNNN
GNNNNNSNGPDFQNSGNANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKF
LQKFQEWTRAHPEDAVSLLELCPQLSFVTAELLLTNGICKVDDLIPLASRPQEEASATNN
NSVNEVVDPAVLNKQKELLKQVLQLNDSQISILPDDERMAIWDLKQKALRGEFGAF



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min