Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852931, KSS1

Organisms

Yeast (4932)

Synonyms

YGR040W;
Mitogen-activated protein kinase (MAPK) involved in signal transduction pathways that control filamentous growth and pheromone response; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains

Description

Kss1p

Xrefs

SGD:S000003272

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

856626 852931 PMID: 16319894

Sequence Information

Nucleotide sequence

>852931 : length: 1107
atggctagaaccataacttttgatatcccttcccaatataaactcgtagatttaataggt
gagggagcgtacggaacagtatgttcagcaattcataagccttccggcataaaggtagct
atcaagaaaatacaaccgtttagcaaaaaattgtttgttacaagaactatacgtgagatc
aagcttttacggtatttccatgaacacgaaaacataataagtatattggataaagtaagg
ccagtatccatagacaaactaaacgctgtttatttagtcgaagagttgatggaaaccgat
ttacaaaaagtaattaataatcagaatagcgggttttccactttaagtgatgaccatgtt
caatactttacataccaaatcctcagagccttaaagtctattcacagtgcacaagttatc
catagagacataaagccatcaaacctgttactaaattccaattgtgatctcaaagtctgc
gattttggactagcgaggtgtttagctagcagtagcgattcaagagaaacattggtagga
ttcatgacggagtacgtcgcaacgcgatggtacagggcacccgagataatgctaactttt
caagagtacacaactgcgatggatatatggtcatgcggatgcattttggctgaaatggtc
tccgggaagcctttgttcccaggcagagactatcatcatcaattatggctaattctagaa
gtcttgggaactccatctttcgaagactttaatcagatcaaatccaagagggctaaagag
tatatagcaaacttacctatgaggccacccttgccatgggagaccgtctggtcaaagacc
gatctgaatccagatatgatagatttactagacaaaatgcttcaattcaatcctgacaaa
agaataagcgcagcagaagctttaagacacccttacctggcaatgtaccatgacccaagt
gatgagccggaatatcctccacttaatttggatgatgaattttggaaactggataacaag
ataatgcgtccggaagaggaggaagaagtgcccatagaaatgctcaaagacatgctttac
gatgaactaatgaagaccatggaatag

Protein sequence

>852931 : length: 368
MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREI
KLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHV
QYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVG
FMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILE
VLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDK
RISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLY
DELMKTME



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min