Center for Bioinformatics
Oxidoreductases | Transferases | Hydrolases | Lyases | Isomerases | Ligases

Basic Information

Gene ID

852976, RPL11B

Organisms

Yeast (4932)

Synonyms

YGR085C;
Rpl11bp

Description

Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Ap; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11

Xrefs

SGD:S000003317

Chromosome

VII : -

Interaction Information

Gene in RLRdb

Interacted gene (Reference)

851152 852976 PMID: 17200106

Sequence Information

Nucleotide sequence

>852976 : length: 525
atgtctactaaagcccaaaaccctatgcgtgatttgaagatcgagaaattggtcttgaac
atctccgttggtgaatctggtgacagattaaccagagcctccaaggttttagaacaatta
tctggtcaaactccagttcaatccaaggccagatacactgtcagaactttcggtatcaga
agaaacgaaaaaattgctgttcacgttaccgtcagaggtccaaaggctgaagaaattttg
gaaagaggtttgaaggtcaaggaataccaattgagagacagaaacttctctgctaccggt
aacttcggtttcggtattgacgaacacattgacttgggtatcaagtatgacccatccatc
ggtattttcggtatggatttctatgtcgtcatgaacagaccaggtgctagagtcactaga
agaaagagatgtaagggtactgttggtaactcccacaagacaactaaggaagacaccgtc
tcttggttcaagcaaaagtacgacgctgatgtgctcgataaataa

Protein sequence

>852976 : length: 174
MSTKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSI
GIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK



  Copyright 2009, Center for Bioinformatics 
  Last Modified: 2009-03-24  
  Design by Zhao Min